UniProt ID | STAP1_MOUSE | |
---|---|---|
UniProt AC | Q9JM90 | |
Protein Name | Signal-transducing adaptor protein 1 | |
Gene Name | Stap1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 297 | |
Subcellular Localization | Nucleus. Cytoplasm . Mitochondrion. | |
Protein Description | May function as an adapter molecule downstream of KIT in the proliferation or differentiation of hematopoietic stem cells.. | |
Protein Sequence | MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLVKRSDHQEYKHYWTELRGTTLFFYTDKKSTIYVGKLDIIDLVCLTGQHSTEKNCAKFTLVLPKEEVHVKTENTESGEEWRGFILTVTELTVPQHVSLLPGQVIRLHEVLEREKKRRIETDQLPLMPPEKEKEPVQDYADVLNPLPECFYAVSRKEATAMLEKNPSWGNMILRPGSDSKNYSITIRQEIEMPRIKHFKVTRTGNNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFIHSADDNFGQDPNIEDRSEKFKKNPHNA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | FFYTDKKSTIYVGKL EEEECCCCEEEEECC | 26.27 | 25367039 | |
63 | Phosphorylation | FYTDKKSTIYVGKLD EEECCCCEEEEECCE | 25.80 | 25367039 | |
65 | Phosphorylation | TDKKSTIYVGKLDII ECCCCEEEEECCEEE | 11.84 | 25367039 | |
170 | Phosphorylation | EKEPVQDYADVLNPL CCCCCCCHHHHHCCC | 6.39 | 25159016 | |
208 | Phosphorylation | NMILRPGSDSKNYSI CEEECCCCCCCCEEE | 41.20 | 20531401 | |
214 | Phosphorylation | GSDSKNYSITIRQEI CCCCCCEEEEEEEEE | 23.73 | 20531401 | |
216 | Phosphorylation | DSKNYSITIRQEIEM CCCCEEEEEEEEEEC | 12.27 | 28285833 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STAP1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STAP1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STAP1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CSF1R_MOUSE | Csf1r | physical | 10679268 | |
LCK_MOUSE | Lck | physical | 10679268 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative time-resolved phosphoproteomic analysis of mast cellsignaling."; Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y.,Kawakami T., Salomon A.R.; J. Immunol. 179:5864-5876(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-170, AND MASSSPECTROMETRY. |