| UniProt ID | STAM1_MOUSE | |
|---|---|---|
| UniProt AC | P70297 | |
| Protein Name | Signal transducing adapter molecule 1 | |
| Gene Name | Stam | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 548 | |
| Subcellular Localization |
Cytoplasm . Early endosome membrane Peripheral membrane protein Cytoplasmic side . |
|
| Protein Description | Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes (By similarity).. | |
| Protein Sequence | MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAIELSLKEQRQQSAPVSTLYPSTSNLLTNHQHEGRKVRAVYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGVGLFPSNFVTADLTAEPEMIKTEKKTVQFNDDVQIETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQSQQYYLQSSAVSASQVYPGPAQSGTYLVAGSAQMTHLQSYSLPPEQLSSISQGAVPSSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIYSPPAAAAAAAAAAVVPVPVPADVTIYQNAGPTMSQVPNYTLTSSTLPQTGGSQQPPQPQQAYSQKALL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Phosphorylation | VCSRDFASEVSNVLN ECCHHHHHHHHHHHH | 38.23 | 22817900 | |
| 133 | Ubiquitination | SLISAMIKNLKEQGV HHHHHHHHHHHHCCC | 43.04 | - | |
| 136 | Ubiquitination | SAMIKNLKEQGVTFP HHHHHHHHHCCCCCC | 58.34 | - | |
| 147 | Phosphorylation | VTFPAIGSQAAEQAK CCCCCCCHHHHHHHH | 15.55 | 29899451 | |
| 154 | Ubiquitination | SQAAEQAKASPALVA HHHHHHHHCCCCEEE | 49.44 | - | |
| 156 | Phosphorylation | AAEQAKASPALVAKD HHHHHHCCCCEEECC | 15.25 | 25521595 | |
| 162 | Ubiquitination | ASPALVAKDPGTVAT CCCCEEECCCCCCCC | 57.91 | - | |
| 171 | Ubiquitination | PGTVATKKEEEDLAK CCCCCCCHHHHHHHH | 67.03 | - | |
| 185 | Ubiquitination | KAIELSLKEQRQQSA HHHHHHHHHHHHHCC | 48.72 | - | |
| 191 | Phosphorylation | LKEQRQQSAPVSTLY HHHHHHHCCCHHHCC | 26.63 | 29472430 | |
| 195 | Phosphorylation | RQQSAPVSTLYPSTS HHHCCCHHHCCCCHH | 16.19 | 29472430 | |
| 196 | Phosphorylation | QQSAPVSTLYPSTSN HHCCCHHHCCCCHHC | 30.46 | 29472430 | |
| 198 | Phosphorylation | SAPVSTLYPSTSNLL CCCHHHCCCCHHCCC | 8.67 | 29472430 | |
| 200 | Phosphorylation | PVSTLYPSTSNLLTN CHHHCCCCHHCCCCC | 30.80 | 29472430 | |
| 201 | Phosphorylation | VSTLYPSTSNLLTNH HHHCCCCHHCCCCCC | 19.68 | 29472430 | |
| 202 | Phosphorylation | STLYPSTSNLLTNHQ HHCCCCHHCCCCCCC | 29.80 | 29472430 | |
| 206 | Phosphorylation | PSTSNLLTNHQHEGR CCHHCCCCCCCCCCC | 33.55 | 29472430 | |
| 276 | Ubiquitination | TAEPEMIKTEKKTVQ CCCHHHEECCCCEEE | 49.69 | - | |
| 353 | Ubiquitination | KLEDIDRKHSELSEL HHHHHHHHCHHHHHH | 47.97 | - | |
| 381 | Phosphorylation | LMNEDPMYSMYAKLQ HCCCCHHHHHHHHHH | 8.82 | 22817900 | |
| 384 | Phosphorylation | EDPMYSMYAKLQSQQ CCHHHHHHHHHHHCC | 8.47 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STAM1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STAM1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STAM1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of STAM1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...