UniProt ID | SSX7_HUMAN | |
---|---|---|
UniProt AC | Q7RTT5 | |
Protein Name | Protein SSX7 | |
Gene Name | SSX7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization | ||
Protein Description | Could act as a modulator of transcription.. | |
Protein Sequence | MNGDDAFARRPRAGAQIPEKIQKSFDDIAKYFSKKEWEKMKSLEKISYVYMKRKYEAMTKLGFKATLPPFMHNTGATDLQGNDFDNDRNQGNQVERPQMTFCRLQRIFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Acetylation | FSKKEWEKMKSLEKI HCHHHHHHHHHHHHH | 53.34 | 7707073 | |
42 | Phosphorylation | KEWEKMKSLEKISYV HHHHHHHHHHHHHHH | 37.96 | 25219547 | |
47 | Phosphorylation | MKSLEKISYVYMKRK HHHHHHHHHHHHHHH | 21.44 | 25219547 | |
48 | Phosphorylation | KSLEKISYVYMKRKY HHHHHHHHHHHHHHH | 10.08 | 25219547 | |
50 | Phosphorylation | LEKISYVYMKRKYEA HHHHHHHHHHHHHHH | 6.67 | 25219547 | |
52 | Methylation | KISYVYMKRKYEAMT HHHHHHHHHHHHHHH | 28.22 | - | |
60 | Methylation | RKYEAMTKLGFKATL HHHHHHHHHCCEECC | 33.26 | - | |
123 | Phosphorylation | PAEEGNDSKGVPEAS CCCCCCCCCCCCCCC | 35.00 | - | |
177 | Phosphorylation | ERKQLVIYEEISDPE HCCEEEEEEECCCCC | 10.46 | 22210691 | |
181 | Phosphorylation | LVIYEEISDPEEDDE EEEEEECCCCCCCCC | 50.85 | 30278072 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSX7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSX7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSX7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SSX7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...