| UniProt ID | SSRA_ARATH | |
|---|---|---|
| UniProt AC | P45434 | |
| Protein Name | Translocon-associated protein subunit alpha | |
| Gene Name | At2g21160 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 258 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. |
|
| Protein Description | TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.. | |
| Protein Sequence | MMNLRVLFLALLLLASPLLQVARCQSDAEDHSSLVDDVVGENTDDAVEEDDHDLDMNLSSFPGVETVCVFPKNSAKLVPAGEETELLVGLKNEGKTRVGVMGIRASVHLPYDHKLLVQNLTMLRLNNASIPTSLQATFPYIFAVSQYLQPGAFDLVGYIIYDVEGKPYQSVFYNGTIEVVESGGLLSGESVFLLTLGIGLLLLLGLWAYSQVQRLTKKTKKVSKVEVGTRSTEASLDEWLEGTTLAKTSSGKTKNKKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 57 | N-linked_Glycosylation | DDHDLDMNLSSFPGV CCCCCCCCHHHCCCC | 36.12 | - | |
| 119 | N-linked_Glycosylation | DHKLLVQNLTMLRLN CHHHHHHCEEEEECC | 29.96 | - | |
| 127 | N-linked_Glycosylation | LTMLRLNNASIPTSL EEEEECCCCCCCHHH | 39.39 | - | |
| 231 | Phosphorylation | KVEVGTRSTEASLDE EEECCCCCCCCCHHH | 30.36 | 30407730 | |
| 232 | Phosphorylation | VEVGTRSTEASLDEW EECCCCCCCCCHHHH | 32.07 | 30407730 | |
| 235 | Phosphorylation | GTRSTEASLDEWLEG CCCCCCCCHHHHHCC | 30.07 | 30407730 | |
| 243 | Phosphorylation | LDEWLEGTTLAKTSS HHHHHCCCCCEECCC | 14.84 | 30407730 | |
| 244 | Phosphorylation | DEWLEGTTLAKTSSG HHHHCCCCCEECCCC | 35.26 | 30407730 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSRA_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSRA_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSRA_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SSRA_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
