UniProt ID | SSPN_HUMAN | |
---|---|---|
UniProt AC | Q14714 | |
Protein Name | Sarcospan | |
Gene Name | SSPN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 243 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane Multi-pass membrane protein. Also found in myotendinous junctions and in the postsynaptic membrane of neuromuscular junctions.. |
|
Protein Description | Component of the dystrophin-glycoprotein complex (DGC), a complex that spans the muscle plasma membrane and forms a link between the F-actin cytoskeleton and the extracellular matrix. Preferentially associates with the sarcoglycan subcomplex of the DGC.. | |
Protein Sequence | MGKNKQPRGQQRQGGPPAADAAGPDDMEPKKGTGAPKECGEEEPRTCCGCRFPLLLALLQLALGIAVTVVGFLMASISSSLLVRDTPFWAGIIVCLVAYLGLFMLCVSYQVDERTCIQFSMKLLYFLLSALGLTVCVLAVAFAAHHYSQLTQFTCETTLDSCQCKLPSSEPLSRTFVYRDVTDCTSVTGTFKLFLLIQMILNLVCGLVCLLACFVMWKHRYQVFYVGVRICSLTASEGPQQKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Acetylation | GPDDMEPKKGTGAPK CCCCCCCCCCCCCCC | 50.99 | 30592665 | |
31 | Acetylation | PDDMEPKKGTGAPKE CCCCCCCCCCCCCCC | 72.86 | 30592669 | |
120 | Phosphorylation | ERTCIQFSMKLLYFL CCHHHHHHHHHHHHH | 9.91 | 24719451 | |
139 | Ubiquitination | GLTVCVLAVAFAAHH HHHHHHHHHHHHHHH | 3.11 | 29901268 | |
148 | Phosphorylation | AFAAHHYSQLTQFTC HHHHHHHHHHHHEEC | 17.85 | - | |
242 | Ubiquitination | ASEGPQQKI------ CCCCCCCCC------ | 45.17 | 29901268 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSPN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSPN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSPN_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPT6H_MOUSE | Supt6 | physical | 17234882 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...