SRTD2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SRTD2_HUMAN
• UniProt AC: Q14140
• Protein Name: SERTA domain-containing protein 2
• Gene Name: SERTAD2
• Organism: Homo sapiens (Human).
• Sequence Length: 314
• Subcellular Localization: Nucleus . Cytoplasm . Exported out of the nucleus via its NES in a XPO1-dependent manner. Once in the cytoplasm, is degraded by the proteasome.
• Protein Description: Acts at E2F-responsive promoters as coregulator to integrate signals provided by PHD- and/or bromodomain-containing transcription factors. May act as coactivator as well as corepressor of E2F1-TFDP1 and E2F4-TFDP1 complexes on E2F consensus binding sites, which would activate or inhibit E2F-target genes expression. Modulates fat storage by down-regulating the expression of key genes involved in adipocyte lipolysis, thermogenesis and oxidative metabolism..
• Protein Sequence: MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Acetylation	----MLGKGGKRKFD ----CCCCCCCCCCC	61.60	12436373
7	Acetylation	-MLGKGGKRKFDEHE -CCCCCCCCCCCCCC	62.17	12436383
23	Phosphorylation	GLEGKIVSPCDGPSK CCCCEEECCCCCCCC	24.23	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SRTD2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SRTD2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SRTD2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ST65G_HUMAN	SUPT7L	physical	17141982
KAT2B_HUMAN	KAT2B	physical	17141982
TIF1B_HUMAN	TRIM28	physical	17141982
XPO1_HUMAN	XPO1	physical	17141982

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.