| UniProt ID | SRSF6_MOUSE | |
|---|---|---|
| UniProt AC | Q3TWW8 | |
| Protein Name | Serine/arginine-rich splicing factor 6 | |
| Gene Name | Srsf6 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 339 | |
| Subcellular Localization | Nucleus . Nucleus speckle . | |
| Protein Description | Plays a role in constitutive splicing and modulates the selection of alternative splice sites. Plays a role in the alternative splicing of MAPT/Tau exon 10. Binds to alternative exons of TNC pre-mRNA and promotes the expression of alternatively spliced TNC. Plays a role in wound healing and in the regulation of keratinocyte differentiation and proliferation via its role in alternative splicing (By similarity).. | |
| Protein Sequence | MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDKYGKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSHSPLPAPPSKARSMSPPPKRASRSRSRSRSRSRSSSRD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | KDIQRFFSGYGRLLE HHHHHHHCCCCCEEE | 22006019 | ||
| 37 | Phosphorylation | EIDLKNGYGFVEFED EEECCCCCEEEEEEC | 25367039 | ||
| 45 | Phosphorylation | GFVEFEDSRDADDAV EEEEEECCCCCCHHH | 22802335 | ||
| 53 | Phosphorylation | RDADDAVYELNSKEL CCCCHHHHEECCHHH | 25159016 | ||
| 80 | Phosphorylation | PRRDRDGYSYGSRSG CCCCCCCCCCCCCCC | 21743459 | ||
| 81 | Phosphorylation | RRDRDGYSYGSRSGG CCCCCCCCCCCCCCC | 21743459 | ||
| 82 | Phosphorylation | RDRDGYSYGSRSGGG CCCCCCCCCCCCCCC | 21743459 | ||
| 84 | Phosphorylation | RDGYSYGSRSGGGGY CCCCCCCCCCCCCCC | 21743459 | ||
| 86 | Phosphorylation | GYSYGSRSGGGGYSS CCCCCCCCCCCCCCC | 27841257 | ||
| 91 | Phosphorylation | SRSGGGGYSSRRTSG CCCCCCCCCCCCCCC | 23140645 | ||
| 92 | Phosphorylation | RSGGGGYSSRRTSGR CCCCCCCCCCCCCCC | 23140645 | ||
| 93 | Phosphorylation | SGGGGYSSRRTSGRD CCCCCCCCCCCCCCC | 23140645 | ||
| 96 | Phosphorylation | GGYSSRRTSGRDKYG CCCCCCCCCCCCCCC | 23140645 | ||
| 97 | Phosphorylation | GYSSRRTSGRDKYGP CCCCCCCCCCCCCCC | 23140645 | ||
| 101 | Acetylation | RRTSGRDKYGPPVRT CCCCCCCCCCCCCCC | 6569527 | ||
| 101 | Ubiquitination | RRTSGRDKYGPPVRT CCCCCCCCCCCCCCC | 27667366 | ||
| 108 | Phosphorylation | KYGPPVRTEYRLIVE CCCCCCCCCHHHHHH | 30635358 | ||
| 110 | Phosphorylation | GPPVRTEYRLIVENL CCCCCCCHHHHHHCH | 30635358 | ||
| 118 | Phosphorylation | RLIVENLSSRCSWQD HHHHHCHHHCCCHHH | 26824392 | ||
| 119 | Phosphorylation | LIVENLSSRCSWQDL HHHHCHHHCCCHHHH | 22942356 | ||
| 122 | Phosphorylation | ENLSSRCSWQDLKDF HCHHHCCCHHHHHHH | 30352176 | ||
| 143 | Ubiquitination | VTYADAHKERTNEGV CEEHHHHHHHCCCCE | 27667366 | ||
| 146 | Phosphorylation | ADAHKERTNEGVIEF HHHHHHHCCCCEEEE | 28066266 | ||
| 157 | Phosphorylation | VIEFRSYSDMKRALD EEEEECHHHHHHHHH | - | ||
| 165 | Acetylation | DMKRALDKLDGTEIN HHHHHHHHCCCCEEC | 23806337 | ||
| 165 | Ubiquitination | DMKRALDKLDGTEIN HHHHHHHHCCCCEEC | 22790023 | ||
| 182 | Acetylation | NIRLIEDKPRTSHRR EEEEECCCCCCCCCC | 2384423 | ||
| 185 | Phosphorylation | LIEDKPRTSHRRSYS EECCCCCCCCCCCCC | 25367039 | ||
| 186 | Phosphorylation | IEDKPRTSHRRSYSG ECCCCCCCCCCCCCC | 25367039 | ||
| 190 | Phosphorylation | PRTSHRRSYSGSRSR CCCCCCCCCCCCHHH | 29514104 | ||
| 192 | Phosphorylation | TSHRRSYSGSRSRSR CCCCCCCCCCHHHHH | 29514104 | ||
| 194 | Phosphorylation | HRRSYSGSRSRSRSR CCCCCCCCHHHHHHH | 29514104 | ||
| 206 | Phosphorylation | RSRRRSRSRSRRSSR HHHHHHHHHHHHHHH | 19367708 | ||
| 208 | Phosphorylation | RRRSRSRSRRSSRSR HHHHHHHHHHHHHHH | 19367708 | ||
| 211 | Phosphorylation | SRSRSRRSSRSRSRS HHHHHHHHHHHHHHH | 19367708 | ||
| 212 | Phosphorylation | RSRSRRSSRSRSRSI HHHHHHHHHHHHHHH | 19367708 | ||
| 214 | Phosphorylation | RSRRSSRSRSRSISK HHHHHHHHHHHHHHH | 20531401 | ||
| 234 | Phosphorylation | RSRSKGRSRSRSKGR HHHCCCCCCCHHHCC | 23375375 | ||
| 236 | Phosphorylation | RSKGRSRSRSKGRKS HCCCCCCCHHHCCCC | 23375375 | ||
| 238 | Phosphorylation | KGRSRSRSKGRKSRS CCCCCCHHHCCCCCC | 23375375 | ||
| 249 | Phosphorylation | KSRSKSKSKPKSDRG CCCCCCCCCCCCCCC | 19367708 | ||
| 253 | Phosphorylation | KSKSKPKSDRGSHSH CCCCCCCCCCCCCCC | 27717184 | ||
| 257 | Phosphorylation | KPKSDRGSHSHSRSR CCCCCCCCCCCCCCC | 27717184 | ||
| 259 | Phosphorylation | KSDRGSHSHSRSRSK CCCCCCCCCCCCCCC | 27717184 | ||
| 276 | Phosphorylation | YGKSRSRSRSRSPKE CCCCCCCCCCCCCCC | 19367708 | ||
| 278 | Phosphorylation | KSRSRSRSRSPKENG CCCCCCCCCCCCCCC | 19367708 | ||
| 280 | Phosphorylation | RSRSRSRSPKENGKG CCCCCCCCCCCCCCC | 19367708 | ||
| 291 | Phosphorylation | NGKGDIKSKSRSRSQ CCCCCCCCCCCCCCC | 29899451 | ||
| 293 | Phosphorylation | KGDIKSKSRSRSQSR CCCCCCCCCCCCCCC | 29899451 | ||
| 295 | Phosphorylation | DIKSKSRSRSQSRSH CCCCCCCCCCCCCCC | 22324799 | ||
| 297 | Phosphorylation | KSKSRSRSQSRSHSP CCCCCCCCCCCCCCC | 26824392 | ||
| 299 | Phosphorylation | KSRSRSQSRSHSPLP CCCCCCCCCCCCCCC | 26824392 | ||
| 301 | Phosphorylation | RSRSQSRSHSPLPAP CCCCCCCCCCCCCCC | 25521595 | ||
| 303 | Phosphorylation | RSQSRSHSPLPAPPS CCCCCCCCCCCCCCH | 27087446 | ||
| 310 | Phosphorylation | SPLPAPPSKARSMSP CCCCCCCHHHCCCCC | 25521595 | ||
| 314 | Phosphorylation | APPSKARSMSPPPKR CCCHHHCCCCCCCCC | 25521595 | ||
| 316 | Phosphorylation | PSKARSMSPPPKRAS CHHHCCCCCCCCCHH | 25521595 | ||
| 323 | Phosphorylation | SPPPKRASRSRSRSR CCCCCCHHCHHHHHH | 21183079 | ||
| 325 | Phosphorylation | PPKRASRSRSRSRSR CCCCHHCHHHHHHHH | 20531401 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 303 | S | Phosphorylation | Kinase | DYRK1A | Q61214 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRSF6_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRSF6_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SRSF6_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...