UniProt ID | SRSF6_MOUSE | |
---|---|---|
UniProt AC | Q3TWW8 | |
Protein Name | Serine/arginine-rich splicing factor 6 | |
Gene Name | Srsf6 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 339 | |
Subcellular Localization | Nucleus . Nucleus speckle . | |
Protein Description | Plays a role in constitutive splicing and modulates the selection of alternative splice sites. Plays a role in the alternative splicing of MAPT/Tau exon 10. Binds to alternative exons of TNC pre-mRNA and promotes the expression of alternatively spliced TNC. Plays a role in wound healing and in the regulation of keratinocyte differentiation and proliferation via its role in alternative splicing (By similarity).. | |
Protein Sequence | MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDSRDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDKYGKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSHSPLPAPPSKARSMSPPPKRASRSRSRSRSRSRSSSRD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
23 | Phosphorylation | KDIQRFFSGYGRLLE HHHHHHHCCCCCEEE | 22006019 | ||
37 | Phosphorylation | EIDLKNGYGFVEFED EEECCCCCEEEEEEC | 25367039 | ||
45 | Phosphorylation | GFVEFEDSRDADDAV EEEEEECCCCCCHHH | 22802335 | ||
53 | Phosphorylation | RDADDAVYELNSKEL CCCCHHHHEECCHHH | 25159016 | ||
80 | Phosphorylation | PRRDRDGYSYGSRSG CCCCCCCCCCCCCCC | 21743459 | ||
81 | Phosphorylation | RRDRDGYSYGSRSGG CCCCCCCCCCCCCCC | 21743459 | ||
82 | Phosphorylation | RDRDGYSYGSRSGGG CCCCCCCCCCCCCCC | 21743459 | ||
84 | Phosphorylation | RDGYSYGSRSGGGGY CCCCCCCCCCCCCCC | 21743459 | ||
86 | Phosphorylation | GYSYGSRSGGGGYSS CCCCCCCCCCCCCCC | 27841257 | ||
91 | Phosphorylation | SRSGGGGYSSRRTSG CCCCCCCCCCCCCCC | 23140645 | ||
92 | Phosphorylation | RSGGGGYSSRRTSGR CCCCCCCCCCCCCCC | 23140645 | ||
93 | Phosphorylation | SGGGGYSSRRTSGRD CCCCCCCCCCCCCCC | 23140645 | ||
96 | Phosphorylation | GGYSSRRTSGRDKYG CCCCCCCCCCCCCCC | 23140645 | ||
97 | Phosphorylation | GYSSRRTSGRDKYGP CCCCCCCCCCCCCCC | 23140645 | ||
101 | Acetylation | RRTSGRDKYGPPVRT CCCCCCCCCCCCCCC | 6569527 | ||
101 | Ubiquitination | RRTSGRDKYGPPVRT CCCCCCCCCCCCCCC | 27667366 | ||
108 | Phosphorylation | KYGPPVRTEYRLIVE CCCCCCCCCHHHHHH | 30635358 | ||
110 | Phosphorylation | GPPVRTEYRLIVENL CCCCCCCHHHHHHCH | 30635358 | ||
118 | Phosphorylation | RLIVENLSSRCSWQD HHHHHCHHHCCCHHH | 26824392 | ||
119 | Phosphorylation | LIVENLSSRCSWQDL HHHHCHHHCCCHHHH | 22942356 | ||
122 | Phosphorylation | ENLSSRCSWQDLKDF HCHHHCCCHHHHHHH | 30352176 | ||
143 | Ubiquitination | VTYADAHKERTNEGV CEEHHHHHHHCCCCE | 27667366 | ||
146 | Phosphorylation | ADAHKERTNEGVIEF HHHHHHHCCCCEEEE | 28066266 | ||
157 | Phosphorylation | VIEFRSYSDMKRALD EEEEECHHHHHHHHH | - | ||
165 | Acetylation | DMKRALDKLDGTEIN HHHHHHHHCCCCEEC | 23806337 | ||
165 | Ubiquitination | DMKRALDKLDGTEIN HHHHHHHHCCCCEEC | 22790023 | ||
182 | Acetylation | NIRLIEDKPRTSHRR EEEEECCCCCCCCCC | 2384423 | ||
185 | Phosphorylation | LIEDKPRTSHRRSYS EECCCCCCCCCCCCC | 25367039 | ||
186 | Phosphorylation | IEDKPRTSHRRSYSG ECCCCCCCCCCCCCC | 25367039 | ||
190 | Phosphorylation | PRTSHRRSYSGSRSR CCCCCCCCCCCCHHH | 29514104 | ||
192 | Phosphorylation | TSHRRSYSGSRSRSR CCCCCCCCCCHHHHH | 29514104 | ||
194 | Phosphorylation | HRRSYSGSRSRSRSR CCCCCCCCHHHHHHH | 29514104 | ||
206 | Phosphorylation | RSRRRSRSRSRRSSR HHHHHHHHHHHHHHH | 19367708 | ||
208 | Phosphorylation | RRRSRSRSRRSSRSR HHHHHHHHHHHHHHH | 19367708 | ||
211 | Phosphorylation | SRSRSRRSSRSRSRS HHHHHHHHHHHHHHH | 19367708 | ||
212 | Phosphorylation | RSRSRRSSRSRSRSI HHHHHHHHHHHHHHH | 19367708 | ||
214 | Phosphorylation | RSRRSSRSRSRSISK HHHHHHHHHHHHHHH | 20531401 | ||
234 | Phosphorylation | RSRSKGRSRSRSKGR HHHCCCCCCCHHHCC | 23375375 | ||
236 | Phosphorylation | RSKGRSRSRSKGRKS HCCCCCCCHHHCCCC | 23375375 | ||
238 | Phosphorylation | KGRSRSRSKGRKSRS CCCCCCHHHCCCCCC | 23375375 | ||
249 | Phosphorylation | KSRSKSKSKPKSDRG CCCCCCCCCCCCCCC | 19367708 | ||
253 | Phosphorylation | KSKSKPKSDRGSHSH CCCCCCCCCCCCCCC | 27717184 | ||
257 | Phosphorylation | KPKSDRGSHSHSRSR CCCCCCCCCCCCCCC | 27717184 | ||
259 | Phosphorylation | KSDRGSHSHSRSRSK CCCCCCCCCCCCCCC | 27717184 | ||
276 | Phosphorylation | YGKSRSRSRSRSPKE CCCCCCCCCCCCCCC | 19367708 | ||
278 | Phosphorylation | KSRSRSRSRSPKENG CCCCCCCCCCCCCCC | 19367708 | ||
280 | Phosphorylation | RSRSRSRSPKENGKG CCCCCCCCCCCCCCC | 19367708 | ||
291 | Phosphorylation | NGKGDIKSKSRSRSQ CCCCCCCCCCCCCCC | 29899451 | ||
293 | Phosphorylation | KGDIKSKSRSRSQSR CCCCCCCCCCCCCCC | 29899451 | ||
295 | Phosphorylation | DIKSKSRSRSQSRSH CCCCCCCCCCCCCCC | 22324799 | ||
297 | Phosphorylation | KSKSRSRSQSRSHSP CCCCCCCCCCCCCCC | 26824392 | ||
299 | Phosphorylation | KSRSRSQSRSHSPLP CCCCCCCCCCCCCCC | 26824392 | ||
301 | Phosphorylation | RSRSQSRSHSPLPAP CCCCCCCCCCCCCCC | 25521595 | ||
303 | Phosphorylation | RSQSRSHSPLPAPPS CCCCCCCCCCCCCCH | 27087446 | ||
310 | Phosphorylation | SPLPAPPSKARSMSP CCCCCCCHHHCCCCC | 25521595 | ||
314 | Phosphorylation | APPSKARSMSPPPKR CCCHHHCCCCCCCCC | 25521595 | ||
316 | Phosphorylation | PSKARSMSPPPKRAS CHHHCCCCCCCCCHH | 25521595 | ||
323 | Phosphorylation | SPPPKRASRSRSRSR CCCCCCHHCHHHHHH | 21183079 | ||
325 | Phosphorylation | PPKRASRSRSRSRSR CCCCHHCHHHHHHHH | 20531401 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
303 | S | Phosphorylation | Kinase | DYRK1A | Q61214 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRSF6_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRSF6_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SRSF6_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...