UniProt ID | SRS6_ARATH | |
---|---|---|
UniProt AC | Q9M2U4 | |
Protein Name | Protein SHI RELATED SEQUENCE 6 | |
Gene Name | SRS6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 183 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM) (By similarity).. | |
Protein Sequence | MLGLRNIILLSPPPTQITRPSLPPVNFAAVEDNNTVGEKVCRDCGNRAKKECLFERCRTCCKSRGYNCVTHVKSTWIPSSATRSSSSPSERKKKLKIDKQSSPNVSLLPTTTSRQERGFREGLPGKIEAPAVFKRTRVTAISNNEQAEIGYQATVTISGHIFKGFLHYYGVDHNKAFPCLSQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of SRS6_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRS6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRS6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRS6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SRS6_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...