UniProt ID | SRS31_ARATH | |
---|---|---|
UniProt AC | P92964 | |
Protein Name | Serine/arginine-rich splicing factor RS31 | |
Gene Name | RS31 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 264 | |
Subcellular Localization | Nucleus speckle . Nucleus, nucleoplasm . In meristematic cells, no apparent accumulation in foci. | |
Protein Description | Required for constitutive and alternative pre-mRNA splicing.. | |
Protein Sequence | MRPVFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAKGERGRPRGDAKAPSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQRSKILDRVVSVEYALKDDDERDDRNGGRSPRRSLSPVYRRRPSPDYGRRPSPGQGRRPSPDYGRARSPEYDRYKGPAAYERRRSPDYGRRSSDYGRQRSPGYDRYRSRSPVPRGRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Phosphorylation | GYEKRRLSVEWAKGE CCCCCEEEEEECCCC | 25561503 | ||
181 | Phosphorylation | GGRSPRRSLSPVYRR CCCCCCHHCCCCCCC | 30291188 | ||
183 | Phosphorylation | RSPRRSLSPVYRRRP CCCCHHCCCCCCCCC | 30291188 | ||
186 | Phosphorylation | RRSLSPVYRRRPSPD CHHCCCCCCCCCCCC | 23776212 | ||
191 | Phosphorylation | PVYRRRPSPDYGRRP CCCCCCCCCCCCCCC | 19880383 | ||
194 | Phosphorylation | RRRPSPDYGRRPSPG CCCCCCCCCCCCCCC | 23776212 | ||
199 | Phosphorylation | PDYGRRPSPGQGRRP CCCCCCCCCCCCCCC | 23776212 | ||
207 | Phosphorylation | PGQGRRPSPDYGRAR CCCCCCCCCCCCCCC | 19880383 | ||
210 | Phosphorylation | GRRPSPDYGRARSPE CCCCCCCCCCCCCCC | 23776212 | ||
215 | Phosphorylation | PDYGRARSPEYDRYK CCCCCCCCCCCCCCC | 19880383 | ||
227 | Phosphorylation | RYKGPAAYERRRSPD CCCCCHHHHHHCCCC | 24894044 | ||
232 | Phosphorylation | AAYERRRSPDYGRRS HHHHHHCCCCCCCCC | 23776212 | ||
235 | Phosphorylation | ERRRSPDYGRRSSDY HHHCCCCCCCCCCCC | 23776212 | ||
239 | Phosphorylation | SPDYGRRSSDYGRQR CCCCCCCCCCCCCCC | - | ||
247 | Phosphorylation | SDYGRQRSPGYDRYR CCCCCCCCCCCCCCC | 19376835 | ||
253 | Phosphorylation | RSPGYDRYRSRSPVP CCCCCCCCCCCCCCC | 23776212 | ||
255 | Phosphorylation | PGYDRYRSRSPVPRG CCCCCCCCCCCCCCC | 23776212 | ||
257 | Phosphorylation | YDRYRSRSPVPRGRP CCCCCCCCCCCCCCC | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRS31_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRS31_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRS31_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SRS31_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...