dbPTM

SRPX_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SRPX_HUMAN
UniProt AC	P78539
Protein Name	Sushi repeat-containing protein SRPX
Gene Name	SRPX
Organism	Homo sapiens (Human).
Sequence Length	464
Subcellular Localization	Cell surface . Possibly surface of photoreceptor cell.
Protein Description	May be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction..
Protein Sequence	MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MGSPAHRPAL -----CCCCCCHHHH	20.02	-
141	Phosphorylation	VDGAYFNSRCEYYCS CCCCEECCCCEEEEC	28.54	30206219
240	O-linked_Glycosylation	GDHKIQYTVYDRAEN CCCEEEEEEEECCCC	9.01	55831505
328	O-linked_Glycosylation	NVNVGVRTAAALLDQ CCCHHHHHHHHHHHH	20.45	55824403
429	Phosphorylation	HGMDKERYVSLVMPV CCCCHHHHHHHHHHH	8.76	28674151
444	Phosphorylation	ALFNLIDTFPLRKEE HHHHHHHHCCCCHHH	21.84	28674151

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SRPX_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SRPX_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SRPX_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SRPX_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SRPX_HUMAN

Related Literatures of Post-Translational Modification