UniProt ID | SRPX_HUMAN | |
---|---|---|
UniProt AC | P78539 | |
Protein Name | Sushi repeat-containing protein SRPX | |
Gene Name | SRPX | |
Organism | Homo sapiens (Human). | |
Sequence Length | 464 | |
Subcellular Localization | Cell surface . Possibly surface of photoreceptor cell. | |
Protein Description | May be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction.. | |
Protein Sequence | MGSPAHRPALLLLLPPLLLLLLLRVPPSRSFPGSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGTRCDIRCQKGYELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGYMKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMSQTCNT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MGSPAHRPAL -----CCCCCCHHHH | 20.02 | - | |
141 | Phosphorylation | VDGAYFNSRCEYYCS CCCCEECCCCEEEEC | 28.54 | 30206219 | |
240 | O-linked_Glycosylation | GDHKIQYTVYDRAEN CCCEEEEEEEECCCC | 9.01 | 55831505 | |
328 | O-linked_Glycosylation | NVNVGVRTAAALLDQ CCCHHHHHHHHHHHH | 20.45 | 55824403 | |
429 | Phosphorylation | HGMDKERYVSLVMPV CCCCHHHHHHHHHHH | 8.76 | 28674151 | |
444 | Phosphorylation | ALFNLIDTFPLRKEE HHHHHHHHCCCCHHH | 21.84 | 28674151 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRPX_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRPX_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRPX_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SRPX_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...