| UniProt ID | SRPRB_RAT | |
|---|---|---|
| UniProt AC | Q4FZX7 | |
| Protein Name | Signal recognition particle receptor subunit beta | |
| Gene Name | Srprb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 269 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. |
|
| Protein Description | Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR (By similarity).. | |
| Protein Sequence | MASANTRRVGDGAGGAFQPYLDSLRQELQQRDPTLLSVAVAVLAVLLTLVFWKFIWSRKSSQRAVLFVGLCDSGKTLLFVRLLTGQYRDTQTSITDSSAIYKVNNNRGNSLTLIDLPGHESLRLQFLDRFKSSARAVVFVVDSATFQREVKDVAEFLYQVLIDSMALKNTPAFLVACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDAGSADVQDLEKWLAKIA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 110 | Phosphorylation | VNNNRGNSLTLIDLP EECCCCCCEEEEECC | 26.09 | 26437020 | |
| 112 | Phosphorylation | NNRGNSLTLIDLPGH CCCCCCEEEEECCCC | 22.84 | 23984901 | |
| 197 | Acetylation | LIQQQLEKELNTLRV HHHHHHHHHHCHHHH | 75.89 | 22902405 | |
| 211 | Phosphorylation | VTRSAAPSTLDSSST HCCCCCCCCCCCCCC | 36.55 | 28432305 | |
| 212 | Phosphorylation | TRSAAPSTLDSSSTA CCCCCCCCCCCCCCC | 33.26 | 28432305 | |
| 215 | Phosphorylation | AAPSTLDSSSTAPAQ CCCCCCCCCCCCCHH | 29.33 | 28432305 | |
| 216 | Phosphorylation | APSTLDSSSTAPAQL CCCCCCCCCCCCHHH | 31.23 | 28432305 | |
| 217 | Phosphorylation | PSTLDSSSTAPAQLG CCCCCCCCCCCHHHC | 32.32 | 28432305 | |
| 218 | Phosphorylation | STLDSSSTAPAQLGK CCCCCCCCCCHHHCC | 38.31 | 28432305 | |
| 255 | Phosphorylation | GGRGDAGSADVQDLE CCCCCCCCCCHHHHH | 24.02 | 28432305 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRPRB_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRPRB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRPRB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SRPRB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
