UniProt ID | SRP19_DROME | |
---|---|---|
UniProt AC | P49963 | |
Protein Name | Signal recognition particle 19 kDa protein | |
Gene Name | Srp19 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 160 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.. | |
Protein Sequence | MATAVPMKKNWSPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLMENKKYCRENSSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGSGGGGGGKKGKGKRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
144 | Phosphorylation | SQPQSNASGSGGGGG CCCCCCCCCCCCCCC | 37.43 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRP19_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRP19_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRP19_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SRP19_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...