SRP19_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SRP19_DROME
• UniProt AC: P49963
• Protein Name: Signal recognition particle 19 kDa protein
• Gene Name: Srp19
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 160
• Subcellular Localization: Cytoplasm.
• Protein Description: Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP..
• Protein Sequence: MATAVPMKKNWSPSMKHNDMERWICIYPAYINRKKTRQEGRRLPKENCVDNPSYIEIRDVLSVSNLQFLMENKKYCRENSSEMEFRGRVRVQLRNVDGTLYNNDFPTRESIMLHIASKIPQLKTRQNKSGDSYHQQSQPQSNASGSGGGGGGKKGKGKRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
144	Phosphorylation	SQPQSNASGSGGGGG CCCCCCCCCCCCCCC	37.43	21082442

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SRP19_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SRP19_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SRP19_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of SRP19_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.