| UniProt ID | SRP09_MOUSE | |
|---|---|---|
| UniProt AC | P49962 | |
| Protein Name | Signal recognition particle 9 kDa protein | |
| Gene Name | Srp9 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 86 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.. | |
| Protein Sequence | MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAKESRNVTMETE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Ubiquitination | EFSRAAEKLYLADPM HHHHHHHHHHCCCCC | 37.39 | 22790023 | |
| 48 | S-palmitoylation | KVTDDLVCLVYRTDQ EECCCEEEEEEECCC | 2.50 | 28526873 | |
| 60 | Acetylation | TDQAQDVKKIEKFHS CCCHHHHHHHHHHHH | 57.22 | 6569635 | |
| 82 | Phosphorylation | AKESRNVTMETE--- HHHHCCCCCCCC--- | 16.91 | - | |
| 85 | Phosphorylation | SRNVTMETE------ HCCCCCCCC------ | 35.85 | 29899451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRP09_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SRP09_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRP09_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SRP09_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...