SRP09_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SRP09_MOUSE
• UniProt AC: P49962
• Protein Name: Signal recognition particle 9 kDa protein
• Gene Name: Srp9
• Organism: Mus musculus (Mouse).
• Sequence Length: 86
• Subcellular Localization: Cytoplasm.
• Protein Description: Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding..
• Protein Sequence: MPQFQTWEEFSRAAEKLYLADPMKVRVVLKYRHVDGNLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLMRLMVAKESRNVTMETE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Ubiquitination	EFSRAAEKLYLADPM HHHHHHHHHHCCCCC	37.39	22790023
48	S-palmitoylation	KVTDDLVCLVYRTDQ EECCCEEEEEEECCC	2.50	28526873
60	Acetylation	TDQAQDVKKIEKFHS CCCHHHHHHHHHHHH	57.22	6569635
82	Phosphorylation	AKESRNVTMETE--- HHHHCCCCCCCC---	16.91	-
85	Phosphorylation	SRNVTMETE------ HCCCCCCCC------	35.85	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SRP09_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SRP09_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SRP09_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SRP09_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.