dbPTM

SRD1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SRD1_YEAST
UniProt AC	P09007
Protein Name	Pre-rRNA-processing protein SRD1
Gene Name	SRD1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	221
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Plays a direct or indirect role in pre-rRNA processing..
Protein Sequence	MRYNNYDNSGSSFLTRVVKKSDMEKTLLLNREIDDWKSNDKKKAYKERGRVYASCSFIEVSFSQIRAVDVEKKIENAEQLRDLTRNIVKNKTSSLNEITPSKNRVTSACNSERRTTSQEANNLEGYHSCAQGTSRSASITKKYSKKTTSRPKREKRQTILPNGEIKECSKCKDTWTIQWRSGPDQNRELCSPCGLAYGKRLKKENEKKRQAADKRIDRNNP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
93	Phosphorylation	NIVKNKTSSLNEITP HHHHCCCCCCCCCCC	34.14	27214570
99	Phosphorylation	TSSLNEITPSKNRVT CCCCCCCCCCCCHHH	18.48	27214570
115	Phosphorylation	ACNSERRTTSQEANN HHCCCCCCCHHHHHH	36.70	28889911
117	Phosphorylation	NSERRTTSQEANNLE CCCCCCCHHHHHHCC	25.97	30377154
145	Acetylation	SITKKYSKKTTSRPK HHHHHHCCCCCCCCC	51.56	25381059
146	Acetylation	ITKKYSKKTTSRPKR HHHHHCCCCCCCCCH	51.61	25381059
147	Phosphorylation	TKKYSKKTTSRPKRE HHHHCCCCCCCCCHH	33.47	30377154
148	Phosphorylation	KKYSKKTTSRPKREK HHHCCCCCCCCCHHH	31.45	28889911
149	Phosphorylation	KYSKKTTSRPKREKR HHCCCCCCCCCHHHC	52.39	25005228

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SRD1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SRD1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SRD1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
DOA1_YEAST	DOA1	genetic	20959818
PHO23_YEAST	PHO23	genetic	20959818

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SRD1_YEAST

Related Literatures of Post-Translational Modification