dbPTM

SR543_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SR543_ARATH
UniProt AC	P49967
Protein Name	Signal recognition particle 54 kDa protein 3
Gene Name	SRP-54C
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	495
Subcellular Localization	Cytoplasm.
Protein Description	Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein)..
Protein Sequence	MVLAELGGRITRAIQQMSNVTIIDEKALNECLNEITRALLQSDVSFPLVKEMQSNIKKIVNLEDLAAGHNKRRIIEQAIFSELCKMLDPGKPAFAPKKAKASVVMFVGLQGAGKTTTCTKYAYYHQKKGYKPALVCADTFRAGAFDQLKQNATKAKIPFYGSYTESDPVKIAVEGVDTFKKENCDLIIVDTSGRHKQEASLFEEMRQVAEATKPDLVIFVMDSSIGQAAFDQAQAFKQSVAVGAVIITKMDGHAKGGGALSAVAATKSPVIFIGTGEHMDEFEVFDVKPFVSRLLGMGDWSGFVDKLQEVVPKDQQPELLEKLSQGNFTLRIMYDQFQNILNMGPLKEVFSMLPGISAEMMPKGHEKESQAKIKRYMTMMDSMTNDELDSSNPKVFNESRMMRIARGSGRQVREVMEMLEEYKRLAKIWSKMKGLKIPKNGDMSALSRNMNAQHMSKVLPPQMLKQIGGMGGLQSLMKQMGSGKDMMGMFGGGDK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
261	Phosphorylation	AKGGGALSAVAATKS CCCCCHHHHHHHCCC	21.84	23776212
266	Phosphorylation	ALSAVAATKSPVIFI HHHHHHHCCCCEEEE	23.47	23776212
482	Phosphorylation	SLMKQMGSGKDMMGM HHHHHHCCCCCCCCC	37.01	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SR543_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SR543_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SR543_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SR543_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SR543_ARATH

Related Literatures of Post-Translational Modification