| UniProt ID | SR34A_ARATH | |
|---|---|---|
| UniProt AC | A2RVS6 | |
| Protein Name | Serine/arginine-rich splicing factor SR34A | |
| Gene Name | SR34A | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 300 | |
| Subcellular Localization | Nucleus speckle . Nucleus, nucleoplasm . | |
| Protein Description | Probably involved in intron recognition and spliceosome assembly.. | |
| Protein Sequence | MSGRFSRSIYVGNLPGDIREHEIEDIFYKYGRIVDIELKVPPRPPCYCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELAHGGRGQSSSDRRGGYGGGGSGYGGGGGGGGSARFGVSRHSEFRVIVRGLPSSASWQDLKDHMRKAGDVCFAEVTRDSDGTYGVVDYTNYDDMKYAIRKLDDTEFRNPWARGFIRVKKYESSRSRSRSPSRSRSRSRSRSRSRGRGRSHSRSRSLSRSKSPRKDLSKSPRRSLSRSISKSRSPSPDKKKSPPRAMSRSKSRSRSRSRSPSKSPPKVREGSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 131 | Phosphorylation | VIVRGLPSSASWQDL EEEECCCCCCCHHHH | 19880383 | ||
| 132 | Phosphorylation | IVRGLPSSASWQDLK EEECCCCCCCHHHHH | 19880383 | ||
| 134 | Phosphorylation | RGLPSSASWQDLKDH ECCCCCCCHHHHHHH | 30291188 | ||
| 172 | Sulfoxidation | DYTNYDDMKYAIRKL CCCCHHHHHHHHHHC | 23289948 | ||
| 207 | Phosphorylation | SSRSRSRSPSRSRSR CCCCCCCCCCHHHHH | - | ||
| 209 | Phosphorylation | RSRSRSPSRSRSRSR CCCCCCCCHHHHHHH | - | ||
| 231 | Phosphorylation | RGRSHSRSRSLSRSK CCCCHHHHHCCCCCC | - | ||
| 233 | Phosphorylation | RSHSRSRSLSRSKSP CCHHHHHCCCCCCCC | - | ||
| 239 | Phosphorylation | RSLSRSKSPRKDLSK HCCCCCCCCCCCCCC | - | ||
| 245 | Phosphorylation | KSPRKDLSKSPRRSL CCCCCCCCCCCCHHH | 23776212 | ||
| 247 | Phosphorylation | PRKDLSKSPRRSLSR CCCCCCCCCCHHHHH | 23776212 | ||
| 259 | Phosphorylation | LSRSISKSRSPSPDK HHHHHHCCCCCCCCC | - | ||
| 269 | Phosphorylation | PSPDKKKSPPRAMSR CCCCCCCCCCCHHHH | 27531888 | ||
| 275 | Phosphorylation | KSPPRAMSRSKSRSR CCCCCHHHHHHCCCC | - | ||
| 285 | Phosphorylation | KSRSRSRSRSPSKSP HCCCCCCCCCCCCCC | 19880383 | ||
| 287 | Phosphorylation | RSRSRSRSPSKSPPK CCCCCCCCCCCCCCC | 24243849 | ||
| 289 | Phosphorylation | RSRSRSPSKSPPKVR CCCCCCCCCCCCCCC | 19880383 | ||
| 291 | Phosphorylation | RSRSPSKSPPKVREG CCCCCCCCCCCCCCC | 19880383 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SR34A_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SR34A_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SR34A_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SR34A_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
