UniProt ID | SPXN4_HUMAN | |
---|---|---|
UniProt AC | Q5MJ08 | |
Protein Name | Sperm protein associated with the nucleus on the X chromosome N4 | |
Gene Name | SPANXN4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 99 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MEEPTSSTNENKMKSPCESNKRKVDKKKKNLHRASAPEQSLKETEKAKYPTLVFYCRKNKKRNSNQLENNQPTESSTDPIKEKGDLDISAGSPQDGGQN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MEEPTSSTNENK ---CCCCCCCCCCCC | 38.29 | 29083192 | |
6 | Phosphorylation | --MEEPTSSTNENKM --CCCCCCCCCCCCC | 45.97 | 29083192 | |
7 | Phosphorylation | -MEEPTSSTNENKMK -CCCCCCCCCCCCCC | 37.42 | 29083192 | |
8 | Phosphorylation | MEEPTSSTNENKMKS CCCCCCCCCCCCCCC | 46.44 | 29083192 | |
15 | Phosphorylation | TNENKMKSPCESNKR CCCCCCCCCCHHHHH | 31.14 | - | |
19 | Phosphorylation | KMKSPCESNKRKVDK CCCCCCHHHHHHHHH | 55.13 | - | |
27 | Acetylation | NKRKVDKKKKNLHRA HHHHHHHHHHHHHHC | 65.60 | 30592577 | |
92 | Phosphorylation | DLDISAGSPQDGGQN CCCCCCCCCCCCCCC | 21.07 | 22617229 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPXN4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPXN4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPXN4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPXN4_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...