SPTSA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPTSA_HUMAN
• UniProt AC: Q969W0
• Protein Name: Serine palmitoyltransferase small subunit A
• Gene Name: SPTSSA
• Organism: Homo sapiens (Human).
• Sequence Length: 71
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16-CoA as substrates, with a slight preference for C14-CoA..
• Protein Sequence: MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHYFEIVQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SPTSA_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPTSA_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPTSA_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPTSA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MBOA7_HUMAN	MBOAT7	physical	23510452

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.