SPT12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPT12_HUMAN
• UniProt AC: Q7Z6I5
• Protein Name: Spermatogenesis-associated protein 12
• Gene Name: SPATA12
• Organism: Homo sapiens (Human).
• Sequence Length: 190
• Protein Sequence: MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCALASCQGPGVLPGAASALPELTFQGDVCQSETCQRYLQAAISLDIAVSQINLLGRPSSPPALLIQQGSCEQVIHNSTPQFLGMEDGDNERTTGWLWRLCEDIDAEPSSTGCSRSNQLTFTEGCFVRSLSTVYSNTHIHTHL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
176	Phosphorylation	TEGCFVRSLSTVYSN CCCEEEEECCHHHCC	22.75	23663014
178	Phosphorylation	GCFVRSLSTVYSNTH CEEEEECCHHHCCCC	19.64	23663014
179	Phosphorylation	CFVRSLSTVYSNTHI EEEEECCHHHCCCCC	28.85	23663014
181	Phosphorylation	VRSLSTVYSNTHIHT EEECCHHHCCCCCCC	9.04	23663014
182	Phosphorylation	RSLSTVYSNTHIHTH EECCHHHCCCCCCCC	30.80	23663014
184	Phosphorylation	LSTVYSNTHIHTHL- CCHHHCCCCCCCCC-	19.10	23663014
188	Phosphorylation	YSNTHIHTHL----- HCCCCCCCCC-----	25.03	23663014

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPT12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPT12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPT12_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SPT12_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.