| UniProt ID | SPR2D_HUMAN | |
|---|---|---|
| UniProt AC | P22532 | |
| Protein Name | Small proline-rich protein 2D | |
| Gene Name | SPRR2D | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 72 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.. | |
| Protein Sequence | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPKSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 20 | Phosphorylation | QPPPVCPTPKCPEPC CCCCCCCCCCCCCCC | 30.19 | 25072903 | |
| 38 | Phosphorylation | KCPEPCPSPKCPQPC CCCCCCCCCCCCCCC | 43.65 | 27422710 | |
| 58 | Phosphorylation | QQKYPPVTPSPPCQP HHCCCCCCCCCCCCC | 24.67 | 25072903 | |
| 60 | Phosphorylation | KYPPVTPSPPCQPKC CCCCCCCCCCCCCCC | 31.91 | 29507054 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPR2D_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPR2D_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPR2D_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPR2D_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...