SPR2D_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPR2D_HUMAN
• UniProt AC: P22532
• Protein Name: Small proline-rich protein 2D
• Gene Name: SPRR2D
• Organism: Homo sapiens (Human).
• Sequence Length: 72
• Subcellular Localization: Cytoplasm.
• Protein Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane..
• Protein Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPPKSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	QPPPVCPTPKCPEPC CCCCCCCCCCCCCCC	30.19	25072903
38	Phosphorylation	KCPEPCPSPKCPQPC CCCCCCCCCCCCCCC	43.65	27422710
58	Phosphorylation	QQKYPPVTPSPPCQP HHCCCCCCCCCCCCC	24.67	25072903
60	Phosphorylation	KYPPVTPSPPCQPKC CCCCCCCCCCCCCCC	31.91	29507054

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPR2D_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPR2D_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPR2D_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SPR2D_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.