SPR2B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPR2B_HUMAN
• UniProt AC: P35325
• Protein Name: Small proline-rich protein 2B
• Gene Name: SPRR2B
• Organism: Homo sapiens (Human).
• Sequence Length: 72
• Subcellular Localization: Cytoplasm.
• Protein Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane..
• Protein Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
20	Phosphorylation	QPPPVCPTPKCPEPC CCCCCCCCCCCCCCC	30.19	25072903
58	Phosphorylation	QQKYPPVTPSPPCQP HHCCCCCCCCCCCCC	24.67	25072903
60	Phosphorylation	KYPPVTPSPPCQPKY CCCCCCCCCCCCCCC	31.91	27966365
67	Phosphorylation	SPPCQPKYPPKSK-- CCCCCCCCCCCCC--	31.30	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPR2B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPR2B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPR2B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SPR2B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.