SPR1B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPR1B_HUMAN
• UniProt AC: P22528
• Protein Name: Cornifin-B
• Gene Name: SPRR1B
• Organism: Homo sapiens (Human).
• Sequence Length: 89
• Subcellular Localization: Cytoplasm.
• Protein Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. Can function as both amine donor and acceptor in transglutaminase-mediated cross-linkage..
• Protein Sequence: MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	QQQKQPCTPPPQLQQ HHHCCCCCCCHHHHH	45.58	26657352
75	Phosphorylation	KVPEPCPSIVTPAPA CCCCCCCCCCCCCCH	36.09	25072903
78	Phosphorylation	EPCPSIVTPAPAQQK CCCCCCCCCCCHHHH	16.44	25072903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPR1B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPR1B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPR1B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SPR1B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.