UniProt ID | SPR1A_HUMAN | |
---|---|---|
UniProt AC | P35321 | |
Protein Name | Cornifin-A | |
Gene Name | SPRR1A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 89 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.. | |
Protein Sequence | MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MNSQQQKQPC -----CCHHHHCCCC | 28.24 | 27135362 | |
11 | Phosphorylation | QQQKQPCTPPPQPQQ HHHCCCCCCCCCCCH | 45.58 | 26657352 | |
41 | S-nitrosylation | IPKTKEPCHPKVPEP CCCCCCCCCCCCCCC | 10.08 | 24105792 | |
49 | S-nitrosylation | HPKVPEPCHPKVPEP CCCCCCCCCCCCCCC | 9.05 | 24105792 | |
57 | S-nitrosylation | HPKVPEPCQPKVPEP CCCCCCCCCCCCCCC | 11.74 | 24105792 | |
68 | Methylation | VPEPCQPKVPEPCPS CCCCCCCCCCCCCCC | 44.54 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPR1A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPR1A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPR1A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPR1A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...