SPOP_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPOP_MOUSE
• UniProt AC: Q6ZWS8
• Protein Name: Speckle-type POZ protein
• Gene Name: Spop
• Organism: Mus musculus (Mouse).
• Sequence Length: 374
• Subcellular Localization: Nucleus . Nucleus speckle .
• Protein Description: Component of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, leading most often to their proteasomal degradation. The cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex containing homodimeric SPOP has higher ubiquitin ligase activity than the complex that contains the heterodimer formed by SPOP and SPOPL (By similarity). In complex with CUL3, involved in ubiquitination and proteasomal degradation of BRMS1, DAXX, PDX1/IPF1, GLI2 and GLI3. In complex with CUL3, involved in ubiquitination of H2AFY and BMI1; this does not lead to their proteasomal degradation. Inhibits transcriptional activation of PDX1/IPF1 targets, such as insulin, by promoting PDX1/IPF1 degradation..
• Protein Sequence: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSRVPSPPP ------CCCCCCCCC	41.82	26745281
6	Phosphorylation	--MSRVPSPPPPAEM --CCCCCCCCCCCHH	47.37	25159016
14	Phosphorylation	PPPPAEMSSGPVAES CCCCCHHCCCCCCCC	24.53	26643407
15	Phosphorylation	PPPAEMSSGPVAESW CCCCHHCCCCCCCCH	45.89	26643407
110	Ubiquitination	KFSILNAKGEETKAM EEEEECCCCHHHHHH	66.82	-
222	Phosphorylation	KAILAARSPVFSAMF HHHHHHCCHHHHHHH	22.23	28059163

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPOP_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPOP_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPOP_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
H2AY_MOUSE	H2afy	physical	12183056

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.