| UniProt ID | SPO11_MOUSE | |
|---|---|---|
| UniProt AC | Q9WTK8 | |
| Protein Name | Meiotic recombination protein SPO11 | |
| Gene Name | Spo11 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 396 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Isoform 1: Component of a topoisomerase 6 complex specifically required for meiotic recombination. Together with TOP6BL, mediates DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination. [PubMed: 26917764 The complex promotes relaxation of negative and positive supercoiled DNA and DNA decatenation through cleavage and ligation cycles. Essential for the phosphorylation of SMC3, HORMAD1 and HORMAD2] | |
| Protein Sequence | MAFAPMGPEASFFDALDRHRASLLAMVKRGAGETPAGATRVASSSEVLTAIENIIQDIIKSLARNEVPAFTIDNRSSWENIMFDDSVGLRMIPQCTTRKIRSDSPKSVKKFALILKVLSMIYKLIQSDTYATKRDIYYTDSQLFGNQAAVDSAIDDISCMLKVPRRSLHVLSTSKGLIAGNLRYMEEDGTRVQCTCSATATAVPTNIQGMQHLITDAKFLLIVEKDATFQRLLDDNFCSRMSPCIMVTGKGVPDLNTRLLVKKLWDTFHIPVFTLVDADPYGIEIMCIYKYGSMSMSFEAHNLTIPTIRWLGLLPSDIQRLNIPKDSLIPLTKHDQMKLDSILKRPYITYQPLWKKELEMMADSKMKAEIQALTLLSSDYLSRVYLPNKLRFGGWI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 43 | Phosphorylation | AGATRVASSSEVLTA CCCEEECCHHHHHHH | 31.38 | 29109428 | |
| 364 | Phosphorylation | ELEMMADSKMKAEIQ HHHHHCCHHHHHHHH | 25.72 | - | |
| 374 | Phosphorylation | KAEIQALTLLSSDYL HHHHHHHHHHCCHHH | 28.77 | - | |
| 377 | Phosphorylation | IQALTLLSSDYLSRV HHHHHHHCCHHHHCC | 25.03 | - | |
| 378 | Phosphorylation | QALTLLSSDYLSRVY HHHHHHCCHHHHCCC | 30.19 | - | |
| 380 | Phosphorylation | LTLLSSDYLSRVYLP HHHHCCHHHHCCCCC | 14.44 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPO11_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPO11_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPO11_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPO11_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...