| UniProt ID | SPNXD_HUMAN | |
|---|---|---|
| UniProt AC | Q9BXN6 | |
| Protein Name | Sperm protein associated with the nucleus on the X chromosome D {ECO:0000305} | |
| Gene Name | SPANXD {ECO:0000312|HGNC:HGNC:14332} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 97 | |
| Subcellular Localization | Cytoplasm. Nucleus. Associated with nuclear craters.. | |
| Protein Description | ||
| Protein Sequence | MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPKKLKTSESSTILVVRYRRNFKRTSPEELVNDHARKNRINPLQMEEEEFMEIMVEIPAK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MDKQSSAGGVKR ---CCCCCCCCCCCC | 28.09 | - | |
| 6 | Phosphorylation | --MDKQSSAGGVKRS --CCCCCCCCCCCCC | 28.56 | - | |
| 13 | Phosphorylation | SAGGVKRSVPCDSNE CCCCCCCCCCCCCHH | 25.37 | 25693802 | |
| 18 | Phosphorylation | KRSVPCDSNEANEMM CCCCCCCCHHHHHCC | 43.20 | 25693802 | |
| 28 | Phosphorylation | ANEMMPETSSGYSDP HHHCCCCCCCCCCCC | 23.48 | 25693802 | |
| 29 | Phosphorylation | NEMMPETSSGYSDPQ HHCCCCCCCCCCCCC | 21.80 | 25693802 | |
| 30 | Phosphorylation | EMMPETSSGYSDPQP HCCCCCCCCCCCCCC | 49.52 | 25693802 | |
| 32 | Phosphorylation | MPETSSGYSDPQPAP CCCCCCCCCCCCCCC | 16.31 | 25693802 | |
| 33 | Phosphorylation | PETSSGYSDPQPAPK CCCCCCCCCCCCCCC | 46.47 | 25693802 | |
| 44 | Phosphorylation | PAPKKLKTSESSTIL CCCCCCCCCCCCEEE | 48.43 | 23186163 | |
| 45 | Phosphorylation | APKKLKTSESSTILV CCCCCCCCCCCEEEE | 33.62 | 26091039 | |
| 47 | Phosphorylation | KKLKTSESSTILVVR CCCCCCCCCEEEEEE | 32.33 | 22777824 | |
| 48 | Phosphorylation | KLKTSESSTILVVRY CCCCCCCCEEEEEEE | 18.53 | 23186163 | |
| 49 | Phosphorylation | LKTSESSTILVVRYR CCCCCCCEEEEEEEC | 27.84 | 25693802 | |
| 62 | Phosphorylation | YRRNFKRTSPEELVN ECCCCCCCCHHHHHH | 49.58 | 30266825 | |
| 63 | Phosphorylation | RRNFKRTSPEELVND CCCCCCCCHHHHHHH | 34.05 | 30266825 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPNXD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPNXD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPNXD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPNXD_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...