SPL5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPL5_ARATH
• UniProt AC: Q9S758
• Protein Name: Squamosa promoter-binding-like protein 5
• Gene Name: SPL5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 181
• Subcellular Localization: Nucleus . Cytoplasm . Mostly located in nucleus.
• Protein Description: Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering..
• Protein Sequence: MEGQRTQRRGYLKDKATVSNLVEEEMENGMDGEEEDGGDEDKRKKVMERVRGPSTDRVPSRLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAKRSCRRRLAGHNERRRKISGDSFGEGSGRRGFSGQLIQTQERNRVDRKLPMTNSSFKRPQIR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
173	Phosphorylation	RKLPMTNSSFKRPQI CCCCCCCCCCCCCCC	28.16	25561503
174	Phosphorylation	KLPMTNSSFKRPQIR CCCCCCCCCCCCCCC	36.54	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPL5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPL5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPL5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SPL5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.