UniProt ID | SPIN4_HUMAN | |
---|---|---|
UniProt AC | Q56A73 | |
Protein Name | Spindlin-4 | |
Gene Name | SPIN4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 249 | |
Subcellular Localization | ||
Protein Description | Exhibits H3K4me3-binding activity.. | |
Protein Sequence | MSPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSPPTVPPM ------CCCCCCCCC | 39.32 | 23401153 | |
5 | Phosphorylation | ---MSPPTVPPMGVD ---CCCCCCCCCCCC | 49.37 | 21406692 | |
15 | Phosphorylation | PMGVDGVSAYLMKKR CCCCCHHHHHHHHHC | 19.41 | 21406692 | |
17 | Phosphorylation | GVDGVSAYLMKKRHT CCCHHHHHHHHHCCC | 10.38 | 23401153 | |
50 | Ubiquitination | CRIQHGWKEGNEPVE EEECCCCCCCCCCHH | 61.41 | 21890473 | |
50 | Ubiquitination | CRIQHGWKEGNEPVE EEECCCCCCCCCCHH | 61.41 | 21890473 | |
81 | Ubiquitination | YIIKYDGKDSVYGLE EEEEECCCCCEEEEE | 43.88 | 29967540 | |
83 | Phosphorylation | IKYDGKDSVYGLELH EEECCCCCEEEEEEC | 22.26 | 30243723 | |
107 | Phosphorylation | ILPERVPTPRIDSRL ECCCCCCCCCCCHHH | 23.49 | 22798277 | |
121 | Ubiquitination | LADSLIGKAVEHVFE HHHHHHHHHHHHHHC | 42.12 | 29967540 | |
134 | Ubiquitination | FEGEHGTKDEWKGMV HCCCCCCCCEECCEE | 59.24 | 29967540 | |
171 | Phosphorylation | MYTLLDDYKDGDLRI EEEECCCCCCCCEEE | 15.62 | 22817900 | |
172 | Ubiquitination | YTLLDDYKDGDLRII EEECCCCCCCCEEEC | 63.33 | 21906983 | |
203 | Ubiquitination | VVDSLVGKQVEHAKD CHHHHCCCCEEECCC | 43.63 | 29967540 | |
241 | Phosphorylation | FDDDIHIYVYGLVKT ECCCEEEEEEEEEEC | 3.57 | 25072903 | |
243 | Phosphorylation | DDIHIYVYGLVKTP- CCEEEEEEEEEECC- | 6.43 | 25072903 | |
248 | Phosphorylation | YVYGLVKTP------ EEEEEEECC------ | 27.10 | 25072903 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPIN4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPIN4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPIN4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPIN4_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...