SPIN1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPIN1_MOUSE
• UniProt AC: Q61142
• Protein Name: Spindlin-1
• Gene Name: Spin1
• Organism: Mus musculus (Mouse).
• Sequence Length: 262
• Subcellular Localization: Nucleus . Cytoplasm, cytoskeleton, spindle . Nucleus, nucleolus . Associates with the meiotic spindle.
• Protein Description: Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (By similarity). Overexpression induces metaphase arrest and chromosomal instability. [PubMed: 18543248 Localizes to active rDNA loci and promotes the expression of rRNA genes. May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption]
• Protein Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MKTPFGKTPG -----CCCCCCCCCC	23.66	-
38	Phosphorylation	TSHKKHRTSVGPSKP CCCCCCCCCCCCCCC	27.73	24719451
39	Phosphorylation	SHKKHRTSVGPSKPV CCCCCCCCCCCCCCC	25.65	24719451
44	Acetylation	RTSVGPSKPVSQPRR CCCCCCCCCCCCCCC	53.20	23806337
44	Ubiquitination	RTSVGPSKPVSQPRR CCCCCCCCCCCCCCC	53.20	22790023
109	Phosphorylation	LNKDERVSALEVLPD CCCCCCEEEEEECCC	33.10	-
120	Phosphorylation	VLPDRVATSRISDAH ECCCHHHHCCCCHHH	18.71	26643407
121	Phosphorylation	LPDRVATSRISDAHL CCCHHHHCCCCHHHH	20.20	23984901
124	Phosphorylation	RVATSRISDAHLADT HHHHCCCCHHHHHHH	27.86	25521595
131	Phosphorylation	SDAHLADTMIGKAVE CHHHHHHHHHHHHHH	12.70	26643407
196	Phosphorylation	DLRIMPDSNDSPPAE CEEECCCCCCCCCCC	36.34	26745281
199	Phosphorylation	IMPDSNDSPPAEREP ECCCCCCCCCCCCCC	36.71	26745281
212	Phosphorylation	EPGEVVDSLVGKQVE CCCCHHHHHCCCEEE	17.22	23984901

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
109	S	Phosphorylation	Kinase	AURKA	P97477	Uniprot
124	S	Phosphorylation	Kinase	AURKA	P97477	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPIN1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPIN1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SPIN1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.