| UniProt ID | SPEE_MOUSE | |
|---|---|---|
| UniProt AC | Q64674 | |
| Protein Name | Spermidine synthase | |
| Gene Name | Srm | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 302 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the production of spermidine from putrescine and decarboxylated S-adenosylmethionine (dcSAM). Has a strong preference for putrescine as substrate, and has very low activity towards 1,3-diaminopropane. Has extremely low activity towards spermidine (By similarity).. | |
| Protein Sequence | MEPGPDGPAAPGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKKFLPGMAVGFSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALNDIS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEPGPDGP -------CCCCCCCC | 14.66 | - | |
| 25 | Glutathionylation | EGWFRETCSLWPGQA CCCEECCCCCCCCCH | 2.42 | 24333276 | |
| 96 | Acetylation | CSHPNPRKVLIIGGG CCCCCCCEEEEECCC | 42.52 | 22826441 | |
| 135 | Acetylation | DVIEVSKKFLPGMAV HHHHHHHHHCCCCEE | 44.63 | 22826441 | |
| 135 | Ubiquitination | DVIEVSKKFLPGMAV HHHHHHHHHCCCCEE | 44.63 | - | |
| 145 | Phosphorylation | PGMAVGFSSSKLTLH CCCEEEECCCEEEEE | 27.98 | 18846507 | |
| 146 | Phosphorylation | GMAVGFSSSKLTLHV CCEEEECCCEEEEEE | 29.27 | 18846507 | |
| 147 | Phosphorylation | MAVGFSSSKLTLHVG CEEEECCCEEEEEEC | 30.41 | 29899451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPEE_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPEE_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPEE_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPEE_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
