UniProt ID | SPCS1_HUMAN | |
---|---|---|
UniProt AC | Q9Y6A9 | |
Protein Name | Signal peptidase complex subunit 1 | |
Gene Name | SPCS1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 102 | |
Subcellular Localization |
Microsome membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.. | |
Protein Sequence | MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | SLPTQMDYKGQKLAE CCCCCCCHHCHHHHH | 50.33 | - | |
15 | Acetylation | LPTQMDYKGQKLAEQ CCCCCCHHCHHHHHH | 33.65 | 26051181 | |
15 | Ubiquitination | LPTQMDYKGQKLAEQ CCCCCCHHCHHHHHH | 33.65 | - | |
18 | Ubiquitination | QMDYKGQKLAEQMFQ CCCHHCHHHHHHHHH | 28.82 | - | |
76 | Ubiquitination | IYRRHPLKWLPVQES CCCCCCCCCCCCCCC | 23.64 | - | |
82 | Ubiquitination | LKWLPVQESSTDDKK CCCCCCCCCCCCCCC | 51.07 | 21890473 | |
83 | Phosphorylation | KWLPVQESSTDDKKP CCCCCCCCCCCCCCC | 24.51 | 30266825 | |
84 | Phosphorylation | WLPVQESSTDDKKPG CCCCCCCCCCCCCCC | 33.18 | 30266825 | |
85 | Ubiquitination | LPVQESSTDDKKPGE CCCCCCCCCCCCCCH | 59.33 | 22817900 | |
85 | Phosphorylation | LPVQESSTDDKKPGE CCCCCCCCCCCCCCH | 59.33 | 30266825 | |
88 | 2-Hydroxyisobutyrylation | QESSTDDKKPGERKI CCCCCCCCCCCHHHH | 53.68 | - | |
88 | Malonylation | QESSTDDKKPGERKI CCCCCCCCCCCHHHH | 53.68 | 26320211 | |
89 | Ubiquitination | ESSTDDKKPGERKIK CCCCCCCCCCHHHHH | 32.17 | - | |
89 | Acetylation | ESSTDDKKPGERKIK CCCCCCCCCCHHHHH | 32.17 | 25953088 | |
89 | Malonylation | ESSTDDKKPGERKIK CCCCCCCCCCHHHHH | 32.17 | 26320211 | |
94 | Acetylation | DKKPGERKIKRHAKN CCCCCHHHHHHHHHC | 1.39 | 7290171 | |
100 | Acetylation | RKIKRHAKNN----- HHHHHHHHCC----- | 2.78 | 7290181 | |
143 | Ubiquitination | ------------------------------------------------ ------------------------------------------------ | 51.65 | 23000965 | |
150 | Phosphorylation | ------------------------------------------------------- ------------------------------------------------------- | 22.80 | 24719451 | |
151 | Phosphorylation | -------------------------------------------------------- -------------------------------------------------------- | 34.79 | 27251275 | |
155 | Malonylation | ------------------------------------------------------------ ------------------------------------------------------------ | 64.77 | 26320211 | |
156 | Malonylation | ------------------------------------------------------------- ------------------------------------------------------------- | 66.31 | 26320211 | |
156 | Ubiquitination | ------------------------------------------------------------- ------------------------------------------------------------- | 66.31 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPCS1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPCS1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPCS1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SPCS1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...