dbPTM

SPC25_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPC25_SCHPO
UniProt AC	Q10430
Protein Name	Kinetochore protein spc25
Gene Name	spc25
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	238
Subcellular Localization	Nucleus . Chromosome, centromere, kinetochore . Associated with kinetochores.
Protein Description	Acts as a component of the NMS (Ndc80-MIND-Spc7) super complex which has a role in kinetochore function during late meiotic prophase and throughout the mitotic cell cycle. Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity..
Protein Sequence	MSLANFPTIELDYDSLKSKISNFNSIFDRFLQEERKKLLNNKNEYLRQLSEINEAQKKAEKSLEQTEARKQNFTELLEKEHEEQAITEQEIFSFQEKLDAMLKRKQKLSEELDHYRAIISSKRELRAQEMEAKRKQDSYNNPELKFWEDYLGLKMEGVHDEVIRFIFTNIDEKDWNKQFSFQINLAERDYKVVHCHPPLPHVDDLVNKVNRTRDFYQFLKDMRKGFRELHRKDLSQLI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SPC25_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPC25_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPC25_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPC25_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SPC24_SCHPO	spc24	physical	15728720

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPC25_SCHPO

Related Literatures of Post-Translational Modification