dbPTM

SPAG4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SPAG4_MOUSE
UniProt AC	Q9JJF2
Protein Name	Sperm-associated antigen 4 protein
Gene Name	Spag4
Organism	Mus musculus (Mouse).
Sequence Length	443
Subcellular Localization	Membrane Multi-pass membrane protein . Cytoplasm, cytoskeleton. Isoform 1: Membrane Multi-pass membrane protein . Cytoplasm, cytoskeleton . Nucleus envelope . Nucleus inner membrane . Cytoplasm, cytoskeleton, flagellum axoneme . In spermatids, i
Protein Description	Involved in spermatogenesis. Required for sperm head formation but not required to establish and maintain general polarity of the sperm head. Required for anchoring and organization of the manchette. Required for targeting of SUN3 and probably SYNE1 through a probable SUN1:SYNE3 LINC complex to the nuclear envelope and involved in accurate posterior sperm head localization of the complex. May anchor SUN3 the nuclear envelope. Involved in maintenance of the nuclear envelope integrity. May assist the organization and assembly of outer dense fibers (ODFs), a specific structure of the sperm tail..
Protein Sequence	MRRSPRSGSAASSHNHTPNFYSENSNSSHSATSGDSNGRRSAGPELGEPEGRRARGSSCGEPALSPGMPGGDTWAGSSRPKLAPRSHNGQTACGAATVRGGASEPSGSSVVLEEQLNLLPILDLRQEMPTPRVSKSFLSLLFQVLSMVLSLAVDGLVCVCREICSIRFLFTAVSLLSIFLAALWWGLLYLIPPLENEPTEMLTLSQYHHRVHSQGQQLQQLQAELNKLHKEVSSVRAAHSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYEDQNTAYFWNRLSFWNYARPPSVILEPDVFPGNCWAFEGDKGQVVIRLPGHVQLSDITLQHPPPTVAHTGGASSAPRDFAVYGLQADDETEVFLGKFIFDVQKSEIQTFHLQNDPPSAFPKVKIQILSNWGHPRFTCLYRVRAHGVRTSEWADDNATGVTGGPH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
57	Phosphorylation	EGRRARGSSCGEPAL CCCCCCCCCCCCCCC	19.53	25293948
58	Phosphorylation	GRRARGSSCGEPALS CCCCCCCCCCCCCCC	29.03	25293948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SPAG4_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SPAG4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SPAG4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SPAG4_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SPAG4_MOUSE

Related Literatures of Post-Translational Modification