| UniProt ID | SPA3K_MOUSE | |
|---|---|---|
| UniProt AC | P07759 | |
| Protein Name | Serine protease inhibitor A3K | |
| Gene Name | Serpina3k | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 418 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Contrapsin inhibits trypsin-like proteases.. | |
| Protein Sequence | MAFIVAMGMILMAGICPAVLCFPDGTKEMDIVFHEHQDNGTQDDSLTLASVNTDFAFSLYKKLALKNPDTNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETPEADIHQGFGNLLQSLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEAKNLINDYVSNQTQGMIKELISELDERTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMKMKLLTTRHFRDEELSCSVLELKYTGNASALLILPDQGRMQQVEASLQPETLRKWRKTLFPSQIEELNLPKFSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETKKLSVSQVVHKAVLDVAETGTEAAAATGVIGGIRKAILPAVHFNRPFLFVIYHTSAQSILFMAKVNNPK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | N-linked_Glycosylation | VFHEHQDNGTQDDSL EEEECCCCCCCCCCE | 49.17 | - | |
| 75 | Phosphorylation | PDTNIVFSPLSISAA CCCCEEECCCHHHHH | 17.65 | 23984901 | |
| 78 | Phosphorylation | NIVFSPLSISAALAL CEEECCCHHHHHHHH | 20.20 | 23984901 | |
| 80 | Phosphorylation | VFSPLSISAALALVS EECCCHHHHHHHHHH | 12.24 | 23984901 | |
| 93 | Ubiquitination | VSLGAKGKTMEEILE HHCCCCCCCHHHHHH | 43.95 | 22790023 | |
| 105 | N-linked_Glycosylation | ILEGLKFNLTETPEA HHHHHCCCCCCCCCC | 44.45 | - | |
| 155 | Ubiquitination | ILAEFHEKTRALYQT HHHHHHHHHHHHHHH | 34.44 | 22790023 | |
| 185 | N-linked_Glycosylation | LINDYVSNQTQGMIK HHHHHHHHHHHHHHH | 38.58 | 16944957 | |
| 235 | Acetylation | SEFYLDEKRSVKVPM EEEECCCCCCCCCCC | 50.03 | 7609137 | |
| 235 | Ubiquitination | SEFYLDEKRSVKVPM EEEECCCCCCCCCCC | 50.03 | 22790023 | |
| 270 | N-linked_Glycosylation | LELKYTGNASALLIL EEEEEECCCEEEEEE | 23.95 | 16944957 | |
| 350 | Acetylation | LSGITETKKLSVSQV CCCCCCCCCCCHHHH | 45.55 | 7612891 | |
| 351 | Acetylation | SGITETKKLSVSQVV CCCCCCCCCCHHHHH | 54.11 | 7609777 | |
| 351 | Ubiquitination | SGITETKKLSVSQVV CCCCCCCCCCHHHHH | 54.11 | 22790023 | |
| 355 | Phosphorylation | ETKKLSVSQVVHKAV CCCCCCHHHHHHHHH | 17.55 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPA3K_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPA3K_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPA3K_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPA3K_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."; Bernhard O.K., Kapp E.A., Simpson R.J.; J. Proteome Res. 6:987-995(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185 AND ASN-270, AND MASSSPECTROMETRY. | |
| "Proteome-wide characterization of N-glycosylation events by diagonalchromatography."; Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J.,Gevaert K.; J. Proteome Res. 5:2438-2447(2006). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185 AND ASN-270, AND MASSSPECTROMETRY. | |
