dbPTM

SOX3A_XENLA - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SOX3A_XENLA
UniProt AC	P55863
Protein Name	Transcription factor Sox-3-A
Gene Name	sox3-a
Organism	Xenopus laevis (African clawed frog).
Sequence Length	309
Subcellular Localization	Nucleus . Cytoplasm . Primarily cytoplasmic in early embryos. Nuclear localization becomes more pronounced as development proceeds.
Protein Description	Transcription factor with sequence-specific DNA binding activity. Binds to the consensus sequence 5'-[AT][AT]CAA[AT]G-3', showing a preference for 5'-AACAAT-3' and 5'-AACAAAG-3'. Inhibits beta-catenin-mediated dorsal axis specification by binding to sites within the promoter of the beta-catenin-regulated gene nodal5. Acts maternally as a transcriptional repressor of nodal5 and nodal6 to restrict their expression to the vegetal hemisphere of early embryos and thus establish germ layer formation. Acts at multiple points to inhibit nodal signaling, repressing the expression of the other mesoderm-inducing nodal genes nodal, nodal2 and nodal4, and also acting downstream to induce expression of genes including trim33/ectodermin, ema and coco, whose products repress nodal signaling..
Protein Sequence	MYSMLDTDIKSPVQQSNAPIGGPATPGGKGNASTLDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSDKRPFIDEAKRLRAVHMKDYPDYKYRPRRKTKTLLKKDKYSLPGNLLAPGVSPVASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPAMNSPQMQQIQHRYDMSGLQYNPMMTSAQNAYMNAAASTYSMSPAYNQQSSTVMSLASMGSVVKSEPSSPPPAITSHTQRACLGDLRDMISMYLPPGGDASDPSLQNSRLHSVHQHYQSAAGPGVNGTVPLTHI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SOX3A_XENLA !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SOX3A_XENLA !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SOX3A_XENLA !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SOX3A_XENLA !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SOX3A_XENLA !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SOX3A_XENLA

Related Literatures of Post-Translational Modification