| UniProt ID | SOX3A_XENLA | |
|---|---|---|
| UniProt AC | P55863 | |
| Protein Name | Transcription factor Sox-3-A | |
| Gene Name | sox3-a | |
| Organism | Xenopus laevis (African clawed frog). | |
| Sequence Length | 309 | |
| Subcellular Localization | Nucleus . Cytoplasm . Primarily cytoplasmic in early embryos. Nuclear localization becomes more pronounced as development proceeds. | |
| Protein Description | Transcription factor with sequence-specific DNA binding activity. Binds to the consensus sequence 5'-[AT][AT]CAA[AT]G-3', showing a preference for 5'-AACAAT-3' and 5'-AACAAAG-3'. Inhibits beta-catenin-mediated dorsal axis specification by binding to sites within the promoter of the beta-catenin-regulated gene nodal5. Acts maternally as a transcriptional repressor of nodal5 and nodal6 to restrict their expression to the vegetal hemisphere of early embryos and thus establish germ layer formation. Acts at multiple points to inhibit nodal signaling, repressing the expression of the other mesoderm-inducing nodal genes nodal, nodal2 and nodal4, and also acting downstream to induce expression of genes including trim33/ectodermin, ema and coco, whose products repress nodal signaling.. | |
| Protein Sequence | MYSMLDTDIKSPVQQSNAPIGGPATPGGKGNASTLDQDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSDKRPFIDEAKRLRAVHMKDYPDYKYRPRRKTKTLLKKDKYSLPGNLLAPGVSPVASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPAMNSPQMQQIQHRYDMSGLQYNPMMTSAQNAYMNAAASTYSMSPAYNQQSSTVMSLASMGSVVKSEPSSPPPAITSHTQRACLGDLRDMISMYLPPGGDASDPSLQNSRLHSVHQHYQSAAGPGVNGTVPLTHI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of SOX3A_XENLA !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SOX3A_XENLA !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SOX3A_XENLA !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOX3A_XENLA !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SOX3A_XENLA !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...