UniProt ID | SOX11_HUMAN | |
---|---|---|
UniProt AC | P35716 | |
Protein Name | Transcription factor SOX-11 | |
Gene Name | SOX11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 441 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional factor involved in the embryonic neurogenesis. May also have a role in tissue modeling during development.. | |
Protein Sequence | MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MVQQAESLEAESNL -CCHHHHHHHHHHCC | 34.23 | 24043423 | |
12 | Phosphorylation | AESLEAESNLPREAL HHHHHHHHCCCHHHH | 51.19 | 24043423 | |
30 | Phosphorylation | EGEFMACSPVALDES CCCEEEECCEECCCC | 16.93 | 27732954 | |
37 | Phosphorylation | SPVALDESDPDWCKT CCEECCCCCCCHHHH | 54.86 | 27732954 | |
60 | Phosphorylation | MNAFMVWSKIERRKI CHHHHHHHHHHHHHH | 16.61 | - | |
71 | Phosphorylation | RRKIMEQSPDMHNAE HHHHHHHCCCHHHHH | 15.01 | 22199227 | |
81 | Ubiquitination | MHNAEISKRLGKRWK HHHHHHHHHHHHHHH | 58.25 | - | |
108 | Ubiquitination | EAERLRLKHMADYPD HHHHHCHHHHHCCCC | 25.54 | - | |
113 | Phosphorylation | RLKHMADYPDYKYRP CHHHHHCCCCCCCCC | 6.62 | 22817900 | |
116 | Phosphorylation | HMADYPDYKYRPRKK HHHCCCCCCCCCCCC | 12.86 | 18083107 | |
117 | Ubiquitination | MADYPDYKYRPRKKP HHCCCCCCCCCCCCC | 42.01 | - | |
129 | Phosphorylation | KKPKMDPSAKPSASQ CCCCCCCCCCCCCCC | 44.66 | 21406692 | |
133 | Phosphorylation | MDPSAKPSASQSPEK CCCCCCCCCCCCCCC | 39.59 | 21406692 | |
135 | Phosphorylation | PSAKPSASQSPEKSA CCCCCCCCCCCCCCC | 35.21 | 21406692 | |
137 | Phosphorylation | AKPSASQSPEKSAAG CCCCCCCCCCCCCCC | 32.31 | 19664995 | |
158 | Acetylation | GGGAGGAKTSKGSSK CCCCCCCCCCCCCCC | 57.51 | 7709615 | |
159 | Phosphorylation | GGAGGAKTSKGSSKK CCCCCCCCCCCCCCC | 34.83 | - | |
163 | Phosphorylation | GAKTSKGSSKKCGKL CCCCCCCCCCCCCCC | 42.60 | - | |
202 | Phosphorylation | GDDYVLGSLRVSGSG CCCEEEEEEEEECCC | 14.61 | 24719451 | |
206 | Phosphorylation | VLGSLRVSGSGGGGA EEEEEEEECCCCCCC | 22.32 | 18669648 | |
278 | Phosphorylation | NVAKVPASPTLSSSA CCCCCCCCCCCCCCC | 16.61 | 15345747 | |
280 | Phosphorylation | AKVPASPTLSSSAES CCCCCCCCCCCCCCC | 36.46 | 27732954 | |
282 | Phosphorylation | VPASPTLSSSAESPE CCCCCCCCCCCCCCC | 25.40 | 27732954 | |
283 | Phosphorylation | PASPTLSSSAESPEG CCCCCCCCCCCCCCC | 36.36 | 27732954 | |
284 | Phosphorylation | ASPTLSSSAESPEGA CCCCCCCCCCCCCCC | 32.45 | 24173317 | |
287 | Phosphorylation | TLSSSAESPEGASLY CCCCCCCCCCCCCHH | 28.15 | 27732954 | |
292 | Phosphorylation | AESPEGASLYDEVRA CCCCCCCCHHHHHHH | 38.02 | 27732954 | |
294 | Phosphorylation | SPEGASLYDEVRAGA CCCCCCHHHHHHHCC | 13.94 | 27732954 | |
316 | Ubiquitination | SRLYYSFKNITKQHP CCEEEECCCCCCCCC | 41.31 | 32142685 | |
332 | Phosphorylation | PLAQPALSPASSRSV CCCCCCCCCCCCCCC | 22.11 | 27732954 | |
335 | Phosphorylation | QPALSPASSRSVSTS CCCCCCCCCCCCCCC | 29.66 | 27732954 | |
336 | Phosphorylation | PALSPASSRSVSTSS CCCCCCCCCCCCCCC | 30.59 | 27732954 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SOX11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SOX11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SOX11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SOX11_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
615866 | Mental retardation, autosomal dominant 27 (MRD27) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-206, AND MASSSPECTROMETRY. |