SORCN_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SORCN_MOUSE
• UniProt AC: Q6P069
• Protein Name: Sorcin
• Gene Name: Sri
• Organism: Mus musculus (Mouse).
• Sequence Length: 198
• Subcellular Localization: Cytoplasm . Sarcoplasmic reticulum membrane ; Peripheral membrane protein ; Cytoplasmic side . Relocates to the sarcoplasmic reticulum membrane in response to elevated calcium levels.
• Protein Description: Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels..
• Protein Sequence: MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMTV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	GPAFPGQTQDPLYGY CCCCCCCCCCCCHHH	40.63	23649490
61	Ubiquitination	LQRCLTQSGIAGGYK HHHHHHHCCCCCCCC	27.25	27667366
112 (in isoform 2)	Ubiquitination	-	9.97	20972266
127	Ubiquitination	VDPQELQKALTTMGF CCHHHHHHHHHHHCC	58.97	22790023
127	Acetylation	VDPQELQKALTTMGF CCHHHHHHHHHHHCC	58.97	22826441
131	Ubiquitination	ELQKALTTMGFRLSP HHHHHHHHHCCCCCH	19.02	27667366
146	Ubiquitination	QTVNSVAKRYSTSGK HHHHHHHHHHCCCCC	50.11	27667366
149	Phosphorylation	NSVAKRYSTSGKITF HHHHHHHCCCCCEEH	21.82	-
155	Phosphorylation	YSTSGKITFDDYIAC HCCCCCEEHHHHHHH	25.21	22871156
165	Acetylation	DYIACCVKLRALTDS HHHHHHHHHHHHHHH	20.52	22826441
172	Phosphorylation	KLRALTDSFRRRDSG HHHHHHHHHHHCCCC	18.54	28833060
178	Phosphorylation	DSFRRRDSGQQGVVN HHHHHCCCCCCCEEE	36.37	15754088

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
178	S	Phosphorylation	Kinase	PRKACA	P17612	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SORCN_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SORCN_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SORCN_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.