UniProt ID | SORCN_MOUSE | |
---|---|---|
UniProt AC | Q6P069 | |
Protein Name | Sorcin | |
Gene Name | Sri | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 198 | |
Subcellular Localization |
Cytoplasm . Sarcoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side . Relocates to the sarcoplasmic reticulum membrane in response to elevated calcium levels. |
|
Protein Description | Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.. | |
Protein Sequence | MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFRLSPQTVNSVAKRYSTSGKITFDDYIACCVKLRALTDSFRRRDSGQQGVVNFSYDDFIQCVMTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | GPAFPGQTQDPLYGY CCCCCCCCCCCCHHH | 40.63 | 23649490 | |
61 | Ubiquitination | LQRCLTQSGIAGGYK HHHHHHHCCCCCCCC | 27.25 | 27667366 | |
112 (in isoform 2) | Ubiquitination | - | 9.97 | 20972266 | |
127 | Ubiquitination | VDPQELQKALTTMGF CCHHHHHHHHHHHCC | 58.97 | 22790023 | |
127 | Acetylation | VDPQELQKALTTMGF CCHHHHHHHHHHHCC | 58.97 | 22826441 | |
131 | Ubiquitination | ELQKALTTMGFRLSP HHHHHHHHHCCCCCH | 19.02 | 27667366 | |
146 | Ubiquitination | QTVNSVAKRYSTSGK HHHHHHHHHHCCCCC | 50.11 | 27667366 | |
149 | Phosphorylation | NSVAKRYSTSGKITF HHHHHHHCCCCCEEH | 21.82 | - | |
155 | Phosphorylation | YSTSGKITFDDYIAC HCCCCCEEHHHHHHH | 25.21 | 22871156 | |
165 | Acetylation | DYIACCVKLRALTDS HHHHHHHHHHHHHHH | 20.52 | 22826441 | |
172 | Phosphorylation | KLRALTDSFRRRDSG HHHHHHHHHHHCCCC | 18.54 | 28833060 | |
178 | Phosphorylation | DSFRRRDSGQQGVVN HHHHHCCCCCCCEEE | 36.37 | 15754088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
178 | S | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SORCN_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SORCN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SORCN_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...