| UniProt ID | SODC_CHICK | |
|---|---|---|
| UniProt AC | P80566 | |
| Protein Name | Superoxide dismutase [Cu-Zn] | |
| Gene Name | SOD1 | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 154 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Destroys radicals which are normally produced within the cells and which are toxic to biological systems.. | |
| Protein Sequence | MATLKAVCVMKGDAPVEGVIHFQQQGSGPVKVTGKITGLSDGDHGFHVHEFGDNTNGCTSAGAHFNPEGKQHGGPKDADRHVGDLGNVTAKGGVAEVEIEDSVISLTGPHCIIGRTMVVHAKSDDLGRGGDNESKLTGNAGPRLACGVIGIAKC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MATLKAVCV ------CCCEEEEEE | 22.95 | 8647082 | |
| 8 | S-palmitoylation | MATLKAVCVMKGDAP CCCEEEEEEEECCCC | 2.71 | - | |
| 154 | S-glutathionyl cysteine | GVIGIAKC------- EEEEEEEC------- | 5.08 | - | |
| 154 | Glutathionylation | GVIGIAKC------- EEEEEEEC------- | 5.08 | 16286078 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SODC_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SODC_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SODC_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KCMA1_CHICK | KCNMA1 | physical | 22174833 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...