UniProt ID | SODC_CHICK | |
---|---|---|
UniProt AC | P80566 | |
Protein Name | Superoxide dismutase [Cu-Zn] | |
Gene Name | SOD1 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 154 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Destroys radicals which are normally produced within the cells and which are toxic to biological systems.. | |
Protein Sequence | MATLKAVCVMKGDAPVEGVIHFQQQGSGPVKVTGKITGLSDGDHGFHVHEFGDNTNGCTSAGAHFNPEGKQHGGPKDADRHVGDLGNVTAKGGVAEVEIEDSVISLTGPHCIIGRTMVVHAKSDDLGRGGDNESKLTGNAGPRLACGVIGIAKC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATLKAVCV ------CCCEEEEEE | 22.95 | 8647082 | |
8 | S-palmitoylation | MATLKAVCVMKGDAP CCCEEEEEEEECCCC | 2.71 | - | |
154 | S-glutathionyl cysteine | GVIGIAKC------- EEEEEEEC------- | 5.08 | - | |
154 | Glutathionylation | GVIGIAKC------- EEEEEEEC------- | 5.08 | 16286078 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SODC_CHICK !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SODC_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SODC_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KCMA1_CHICK | KCNMA1 | physical | 22174833 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...