SNX1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNX1_ARATH
• UniProt AC: Q9FG38
• Protein Name: Sorting nexin 1
• Gene Name: SNX1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 402
• Subcellular Localization: Cytoplasm. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Prevacuolar compartment membrane; Peripheral membrane protein; Cytoplasmic side. Golgi apparatus, trans-Golgi network membrane; Peripheral membrane protein; Cytoplasmic side.
• Protein Description: Plays a role in vesicular protein sorting. Acts at the crossroads between the secretory and endocytic pathways. Is involved in the endosome to vacuole protein transport via its interaction with the BLOS1/2 proteins and, as component of the membrane-associated retromer complex, is also involved in endosome-to-Golgi retrograde transport. Required for the auxin-carrier protein PIN2 sorting to the lytic vacuolar pathway and the trafficking of several plasma membrane proteins. Also involved in the efficient sorting of seed storage protein globulin 12S..
• Protein Sequence: MESTEQPRNISGSMQSPRSPSSHPYLSVSVTDPVKLGNGVQAYISYRVITKTNLPEYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRAALDIFVNRIALHPELQQSEDLRTFLQADEETMDRFRFQETSIFKKPADLMQMFRDVQSKVSDAVLGKEKPVEETTADYEKLKHYIFELENHLTEAQKHAYRLVKRHRELGQSLLDFGKAVKLLGACEGEPTGKAFSDLGTKSELLSIKLQKEAQQVLMNFEEPLKDYVRYVQSIKATIAERGTAFKQHCELSETTKLKEINLDKLMLTRSDKVGEAEIEYREIKAESEEATRRFERIVKRMEDEIVRFQEQKTEEMGVAFHQFAKGQARLANSVADAWRSLLPKLEASYSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	TEQPRNISGSMQSPR CCCCCCCCCCCCCCC	28.50	23776212
13	Phosphorylation	QPRNISGSMQSPRSP CCCCCCCCCCCCCCC	13.58	23776212
16	Phosphorylation	NISGSMQSPRSPSSH CCCCCCCCCCCCCCC	17.40	19880383
19	Phosphorylation	GSMQSPRSPSSHPYL CCCCCCCCCCCCCCE	32.30	23776212
21	Phosphorylation	MQSPRSPSSHPYLSV CCCCCCCCCCCCEEE	42.39	23776212
22	Phosphorylation	QSPRSPSSHPYLSVS CCCCCCCCCCCEEEE	31.68	23776212
25	Phosphorylation	RSPSSHPYLSVSVTD CCCCCCCCEEEEECC	13.24	23776212
27	Phosphorylation	PSSHPYLSVSVTDPV CCCCCCEEEEECCCE	13.40	23776212
29	Phosphorylation	SHPYLSVSVTDPVKL CCCCEEEEECCCEEC	18.87	23776212
31	Phosphorylation	PYLSVSVTDPVKLGN CCEEEEECCCEECCC	27.38	23776212
401	Phosphorylation	PKLEASYSV------ HHHHHHCCC------	20.89	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SNX1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNX1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNX1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SNX1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.