UniProt ID | SNX12_MOUSE | |
---|---|---|
UniProt AC | O70493 | |
Protein Name | Sorting nexin-12 | |
Gene Name | Snx12 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 165 | |
Subcellular Localization |
Membrane Peripheral membrane protein Cytoplasmic side . |
|
Protein Description | May be involved in several stages of intracellular trafficking.. | |
Protein Sequence | MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRHPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVAGKVLGEKDC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSDTAVADT ------CCCCHHHCH | 43.60 | - | |
2 | Phosphorylation | ------MSDTAVADT ------CCCCHHHCH | 43.60 | 26824392 | |
4 | Phosphorylation | ----MSDTAVADTRR ----CCCCHHHCHHH | 18.74 | 28066266 | |
14 | Phosphorylation | ADTRRLNSKPQDLTD HCHHHHCCCCCCCHH | 50.75 | 23984901 | |
20 | Phosphorylation | NSKPQDLTDAYGPPS CCCCCCCHHCCCCCC | 27.20 | 23984901 | |
23 | Phosphorylation | PQDLTDAYGPPSNFL CCCCHHCCCCCCCCE | 32.73 | 23984901 | |
27 | Phosphorylation | TDAYGPPSNFLEIDI HHCCCCCCCCEEEEE | 43.26 | 26745281 | |
62 | Ubiquitination | RTNLPIFKLKESCVR HCCCCEEECHHHHHH | 60.41 | - | |
72 | Phosphorylation | ESCVRRRYSDFEWLK HHHHHHCCCCHHHHH | 15.69 | 27180971 | |
73 | Phosphorylation | SCVRRRYSDFEWLKN HHHHHCCCCHHHHHH | 33.73 | 26824392 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNX12_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNX12_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNX12_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SNX12_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...