dbPTM

SNX12_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SNX12_MOUSE
UniProt AC	O70493
Protein Name	Sorting nexin-12
Gene Name	Snx12
Organism	Mus musculus (Mouse).
Sequence Length	165
Subcellular Localization	Membrane Peripheral membrane protein Cytoplasmic side .
Protein Description	May be involved in several stages of intracellular trafficking..
Protein Sequence	MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRHPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVAGKVLGEKDC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSDTAVADT ------CCCCHHHCH	43.60	-
2	Phosphorylation	------MSDTAVADT ------CCCCHHHCH	43.60	26824392
4	Phosphorylation	----MSDTAVADTRR ----CCCCHHHCHHH	18.74	28066266
14	Phosphorylation	ADTRRLNSKPQDLTD HCHHHHCCCCCCCHH	50.75	23984901
20	Phosphorylation	NSKPQDLTDAYGPPS CCCCCCCHHCCCCCC	27.20	23984901
23	Phosphorylation	PQDLTDAYGPPSNFL CCCCHHCCCCCCCCE	32.73	23984901
27	Phosphorylation	TDAYGPPSNFLEIDI HHCCCCCCCCEEEEE	43.26	26745281
62	Ubiquitination	RTNLPIFKLKESCVR HCCCCEEECHHHHHH	60.41	-
72	Phosphorylation	ESCVRRRYSDFEWLK HHHHHHCCCCHHHHH	15.69	27180971
73	Phosphorylation	SCVRRRYSDFEWLKN HHHHHCCCCHHHHHH	33.73	26824392

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SNX12_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SNX12_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SNX12_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SNX12_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SNX12_MOUSE

Related Literatures of Post-Translational Modification