SNAPN_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SNAPN_RAT
• UniProt AC: P60192
• Protein Name: SNARE-associated protein Snapin
• Gene Name: Snapin
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 136
• Subcellular Localization: Membrane ; Peripheral membrane protein ; Cytoplasmic side . Cytoplasm, cytosol . Cytoplasm, perinuclear region . Golgi apparatus membrane . Lysosome membrane . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane . Colocalizes with NANOS
• Protein Description: Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells. [PubMed: 10195194]
• Protein Sequence: MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAAGSAAV ------CCCCCCCCC	13.15	-
10	Phosphorylation	AAGSAAVSGAGTPVA CCCCCCCCCCCCCCC	20.42	23984901
14	Phosphorylation	AAVSGAGTPVAGPTG CCCCCCCCCCCCCCH	17.66	27097102
20	Phosphorylation	GTPVAGPTGRDLFAE CCCCCCCCHHHHHHH	43.88	25575281
50	Phosphorylation	HVHAVRESQVELREQ HHHHHHHHHHHHHHH	29.03	-
126	Phosphorylation	RRRAMLDSGVYPPGS HHHHHHHCCCCCCCC	26.63	22673903
129	Phosphorylation	AMLDSGVYPPGSPSK HHHHCCCCCCCCCCC	13.77	28432305
133	Phosphorylation	SGVYPPGSPSK---- CCCCCCCCCCC----	31.60	27097102
135	Phosphorylation	VYPPGSPSK------ CCCCCCCCC------	53.33	27097102

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
50	S	Phosphorylation	Kinase	PRKACA	P05132	GPS
50	S	Phosphorylation	Kinase	PKA	-	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SNAPN_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SNAPN_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of SNAPN_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.