UniProt ID | SNAA2_ARATH | |
---|---|---|
UniProt AC | Q9SPE6 | |
Protein Name | Alpha-soluble NSF attachment protein 2 | |
Gene Name | ASNAP2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 289 | |
Subcellular Localization |
Membrane Peripheral membrane protein. |
|
Protein Description | Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Binds to SNARE complex and then recruits NSF to disassemble it (By similarity).. | |
Protein Sequence | MGDHLVRAEEFEKKAEKKLNGWGIFGSKYEDAADLLEKAANSYKLAKSWDQAGKAYLKLADCHLKSDSKHDAANAYAEAAKCYKKVDTNEAASCLERAVNIFCEIGRLNMAARYYKEIAEYYESDQKFEQAIAYFEKAAEFFQNEEVTTSANQCNLKVAQYAAQLEQYEKAIKIYEDIARHSLNNNLLKYGVKGHLLTAGMCHLCKADVVSITNALEKYQDLDPTFTGTRECKFLADLASAIDEEDIAKFTDVVKEFDSMTPLDSWKTTMLLRVKEKLKAKELEEDDLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
211 | Phosphorylation | LCKADVVSITNALEK HHHCHHHHHHHHHHH | 24.44 | 30291188 | |
213 | Phosphorylation | KADVVSITNALEKYQ HCHHHHHHHHHHHHC | 13.61 | 19880383 | |
261 | Phosphorylation | VKEFDSMTPLDSWKT HHHHCCCCCCCHHHH | 25.34 | 23572148 | |
265 | Phosphorylation | DSMTPLDSWKTTMLL CCCCCCCHHHHHHHH | 37.85 | 23572148 | |
268 | Phosphorylation | TPLDSWKTTMLLRVK CCCCHHHHHHHHHHH | 15.92 | 23572148 | |
269 | Phosphorylation | PLDSWKTTMLLRVKE CCCHHHHHHHHHHHH | 11.33 | 23572148 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNAA2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNAA2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNAA2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SNAA2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...