dbPTM

SNAA2_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SNAA2_ARATH
UniProt AC	Q9SPE6
Protein Name	Alpha-soluble NSF attachment protein 2
Gene Name	ASNAP2
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	289
Subcellular Localization	Membrane Peripheral membrane protein.
Protein Description	Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Binds to SNARE complex and then recruits NSF to disassemble it (By similarity)..
Protein Sequence	MGDHLVRAEEFEKKAEKKLNGWGIFGSKYEDAADLLEKAANSYKLAKSWDQAGKAYLKLADCHLKSDSKHDAANAYAEAAKCYKKVDTNEAASCLERAVNIFCEIGRLNMAARYYKEIAEYYESDQKFEQAIAYFEKAAEFFQNEEVTTSANQCNLKVAQYAAQLEQYEKAIKIYEDIARHSLNNNLLKYGVKGHLLTAGMCHLCKADVVSITNALEKYQDLDPTFTGTRECKFLADLASAIDEEDIAKFTDVVKEFDSMTPLDSWKTTMLLRVKEKLKAKELEEDDLT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
211	Phosphorylation	LCKADVVSITNALEK HHHCHHHHHHHHHHH	24.44	30291188
213	Phosphorylation	KADVVSITNALEKYQ HCHHHHHHHHHHHHC	13.61	19880383
261	Phosphorylation	VKEFDSMTPLDSWKT HHHHCCCCCCCHHHH	25.34	23572148
265	Phosphorylation	DSMTPLDSWKTTMLL CCCCCCCHHHHHHHH	37.85	23572148
268	Phosphorylation	TPLDSWKTTMLLRVK CCCCHHHHHHHHHHH	15.92	23572148
269	Phosphorylation	PLDSWKTTMLLRVKE CCCHHHHHHHHHHHH	11.33	23572148

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SNAA2_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SNAA2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SNAA2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SNAA2_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SNAA2_ARATH

Related Literatures of Post-Translational Modification