SMUG1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMUG1_HUMAN
• UniProt AC: Q53HV7
• Protein Name: Single-strand selective monofunctional uracil DNA glycosylase
• Gene Name: SMUG1
• Organism: Homo sapiens (Human).
• Sequence Length: 270
• Subcellular Localization: Nucleus .
• Protein Description: Recognizes base lesions in the genome and initiates base excision DNA repair. Acts as a monofunctional DNA glycosylase specific for uracil (U) residues in DNA with a preference for single-stranded DNA substrates. The activity is greater toward mismatches (U/G) compared to matches (U/A). Excises uracil (U), 5-formyluracil (fU) and uracil derivatives bearing an oxidized group at C5 [5-hydroxyuracil (hoU) and 5-hydroxymethyluracil (hmU)] in ssDNA and dsDNA, but not analogous cytosine derivatives (5-hydroxycytosine and 5-formylcytosine), nor other oxidized bases. The activity is damage-specific and salt-dependent. The substrate preference is the following: ssDNA > dsDNA (G pair) = dsDNA (A pair) at low salt concentration, and dsDNA (G pair) > dsDNA (A pair) > ssDNA at high salt concentration..
• Protein Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPAELPAKQREQLLGICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHPSPRNPQANKGWEAVAKERLNELGLLPLLLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	PQAFLLGSIHEPAGA CCEEEECCCCCCCCC	22.27	24043423
26	Phosphorylation	EPQPCPGSLAESFLE CCCCCCCCHHHHHHH	15.00	24043423
30	Phosphorylation	CPGSLAESFLEEELR CCCCHHHHHHHHHHH	29.53	24043423
185	Ubiquitination	TPAELPAKQREQLLG CHHHCCHHHHHHHHH	48.20	-
241	Phosphorylation	VEGLLHPSPRNPQAN EEECCCCCCCCCCCC	26.24	17081983

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMUG1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMUG1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMUG1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UNG_HUMAN	UNG	physical	22939629
VAC14_HUMAN	VAC14	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.