SMT2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMT2_ARATH
• UniProt AC: Q39227
• Protein Name: 24-methylenesterol C-methyltransferase 2
• Gene Name: SMT2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 361
• Protein Description: Catalyzes the methyl transfer from S-adenosyl-methionine to the methylene group of 24-methylene lophenol to form 24-ethylidene lophenol..
• Protein Sequence: MDSLTLFFTGALVAVGIYWFLCVLGPAERKGKRAVDLSGGSISAEKVQDNYKQYWSFFRRPKEIETAEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQVKPGQKILDVGCGVGGPMRAIASHSRANVVGITINEYQVNRARLHNKKAGLDALCEVVCGNFLQMPFDDNSFDGAYSIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWVTTEKFKAEDDEHVEVIQGIERGDALPGLRAYVDIAETAKKVGFEIVKEKDLASPPAEPWWTRLKMGRLAYWRNHIVVQILSAVGVAPKGTVDVHEMLFKTADYLTRGGETGIFSPMHMILCRKPESPEESS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Phosphorylation	AVDLSGGSISAEKVQ EEECCCCCCCHHHHH	19.52	23111157
43	Phosphorylation	DLSGGSISAEKVQDN ECCCCCCCHHHHHHH	31.88	25561503
360	Phosphorylation	KPESPEESS------ CCCCCCCCC------	39.42	25561503
361	Phosphorylation	PESPEESS------- CCCCCCCC-------	47.74	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMT2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMT2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMT2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SMT2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.