UniProt ID | SMS_HUMAN | |
---|---|---|
UniProt AC | P61278 | |
Protein Name | Somatostatin | |
Gene Name | SST | |
Organism | Homo sapiens (Human). | |
Sequence Length | 116 | |
Subcellular Localization | Secreted. | |
Protein Description | Somatostatin inhibits the release of somatotropin.. | |
Protein Sequence | MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEPNQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MLSCRLQCAL -----CCHHHHHHHH | 8.90 | 22210691 | |
14 | Phosphorylation | QCALAALSIVLALGC HHHHHHHHHHHHHHH | 13.11 | 22210691 | |
23 | Phosphorylation | VLALGCVTGAPSDPR HHHHHHHHCCCCCHH | 31.53 | 22210691 | |
27 | Phosphorylation | GCVTGAPSDPRLRQF HHHHCCCCCHHHHHH | 60.76 | 22210691 | |
43 | Amidation | QKSLAAAAGKQELAK HHHHHHHHCHHHHHH | 22.46 | - | |
58 | Phosphorylation | YFLAELLSEPNQTEN HHHHHHHCCCCCCCC | 64.73 | 26657352 | |
74 | Phosphorylation | ALEPEDLSQAAEQDE CCCHHHHHHHHHHHH | 30.05 | 26657352 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMS_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMS_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMS_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SMS_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...