UniProt ID | SMRD2_MOUSE | |
---|---|---|
UniProt AC | Q99JR8 | |
Protein Name | SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 | |
Gene Name | Smarcd2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 531 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Critical regulator of myeloid differentiation, controlling granulocytopoiesis and the expression of genes involved in neutrophil granule formation.. | |
Protein Sequence | MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPSPALRGPGPSGGMGVPGAAAFRPMGPAGPAAQYQRPGMSPGSRMPMAGLQVGPPAGSPFGTAAPLRPGMPPTMMDPFRKRLLVPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIYISNTFSPSKADGDNAGTAGTPGGTPAADKVASWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTEPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGRGAGGF ------CCCCCCCCC | 36.88 | 25777480 | |
15 | Phosphorylation | GFPLPPLSPGGGAVA CCCCCCCCCCCCHHH | 27.54 | 24719451 | |
39 | Phosphorylation | AGPGMLPSPALRGPG CCCCCCCCHHHCCCC | 20.88 | 25777480 | |
81 | Asymmetric dimethylarginine | PGMSPGSRMPMAGLQ CCCCCCCCCCCCCCE | 38.86 | - | |
81 | Methylation | PGMSPGSRMPMAGLQ CCCCCCCCCCCCCCE | 38.86 | - | |
104 | Methylation | FGTAAPLRPGMPPTM CCCCCCCCCCCCCCC | 25.35 | - | |
104 | Asymmetric dimethylarginine | FGTAAPLRPGMPPTM CCCCCCCCCCCCCCC | 25.35 | - | |
185 | Acetylation | MEIQEAIKKPLTQKR HHHHHHHHCCCCCCC | 56.22 | 15608251 | |
197 | Phosphorylation | QKRKLRIYISNTFSP CCCCEEEEEECCCCC | 7.58 | 25619855 | |
199 | Phosphorylation | RKLRIYISNTFSPSK CCEEEEEECCCCCCC | 16.91 | 25619855 | |
201 | Phosphorylation | LRIYISNTFSPSKAD EEEEEECCCCCCCCC | 20.78 | 25619855 | |
203 | Phosphorylation | IYISNTFSPSKADGD EEEECCCCCCCCCCC | 26.65 | 26824392 | |
205 | Phosphorylation | ISNTFSPSKADGDNA EECCCCCCCCCCCCC | 39.00 | 25619855 | |
214 | Phosphorylation | ADGDNAGTAGTPGGT CCCCCCCCCCCCCCC | 21.36 | 25619855 | |
217 | Phosphorylation | DNAGTAGTPGGTPAA CCCCCCCCCCCCCCH | 19.12 | 25521595 | |
221 | Phosphorylation | TAGTPGGTPAADKVA CCCCCCCCCCHHHHC | 18.70 | 25619855 | |
244 | Ubiquitination | KLLDDPSKQKRKFSS EECCCHHHHHHHHHH | 66.29 | - | |
262 | Ubiquitination | SLVIELDKELYGPDN HHHHHHHHHHHCCCC | 63.34 | - | |
289 | Ubiquitination | ETDGFQVKRPGDLNV CCCCCEECCCCCCCC | 41.93 | - | |
325 | Phosphorylation | ARLLGVHTQTRAAIM HHHHCCCHHHHHHHH | 29.27 | 28066266 | |
327 | Phosphorylation | LLGVHTQTRAAIMQA HHCCCHHHHHHHHHH | 24.35 | 28066266 | |
352 | Phosphorylation | QDGHEREYINCNRYF CCCCCCCCCCHHHHH | 12.03 | - | |
451 | Ubiquitination | IESINQLKTQRDFML HHHHHHHHHCHHHHH | 32.61 | - | |
459 | Phosphorylation | TQRDFMLSFSTEPQD HCHHHHHHCCCCHHH | 12.83 | 21454597 | |
461 | Phosphorylation | RDFMLSFSTEPQDFI HHHHHHCCCCHHHHH | 28.60 | 21454597 | |
462 | Phosphorylation | DFMLSFSTEPQDFIQ HHHHHCCCCHHHHHH | 50.07 | 21454597 | |
480 | Ubiquitination | RSQRRDLKIITDVIG HHCCCCCCHHHHCCC | 36.03 | - | |
514 | Ubiquitination | VGRHIFAKVQQRRQE HHHHHHHHHHHHHHH | 29.81 | - | |
531 | Phosphorylation | QVLGIRLT------- HHHCCCCC------- | 27.07 | 27600695 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMRD2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMRD2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMRD2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SMRD2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...