UniProt ID | SMOC2_HUMAN | |
---|---|---|
UniProt AC | Q9H3U7 | |
Protein Name | SPARC-related modular calcium-binding protein 2 | |
Gene Name | SMOC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 446 | |
Subcellular Localization | Secreted, extracellular space, extracellular matrix, basement membrane. | |
Protein Description | Promotes matrix assembly and cell adhesiveness (By similarity). Can stimulate endothelial cell proliferation, migration, as well as angiogenesis.. | |
Protein Sequence | MLLPQLCWLPLLAGLLPPVPAQKFSALTFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGNCKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCWCVTPNGRPISGTAVAHKTPRCPGSVNEKLPQREGTGKTDDAAAPALETQPQGDEEDIASRYPTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHPSTGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQLQGCPGAKKHEFLTSVLDALSTDMVHAASDPSSSSGRLSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIKPFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRHTPRGHAESTSNRQPRKQG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | Methylation | LSRCEFQRAKCKDPQ HHHHHHHHHCCCCCC | 41.14 | 115917289 | |
193 | Phosphorylation | EEDIASRYPTLWTEQ HHHHHHHCCCHHHHH | 9.70 | 18083107 | |
206 | N-linked_Glycosylation | EQVKSRQNKTNKNSV HHHHHHCCCCCCCCC | 52.59 | UniProtKB CARBOHYD | |
362 | N-linked_Glycosylation | YFKLLDKNSSGDIGK HHHHHCCCCCCCCCC | 40.86 | UniProtKB CARBOHYD | |
363 | O-linked_Glycosylation | FKLLDKNSSGDIGKK HHHHCCCCCCCCCCH | 41.25 | 30620550 | |
403 | Phosphorylation | CDVNNDKSISVQELM HCCCCCCCEEHHHHH | 23.98 | 24719451 | |
414 | Phosphorylation | QELMGCLGVAKEDGK HHHHHHHHHHHCCCC | 22.78 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMOC2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMOC2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMOC2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SMOC2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
125400 | Dentin dysplasia 1 (DTDP1) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...