UniProt ID | SMIM7_HUMAN | |
---|---|---|
UniProt AC | Q9BQ49 | |
Protein Name | Small integral membrane protein 7 | |
Gene Name | SMIM7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 75 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | ||
Protein Sequence | MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMIVLFGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Ubiquitination | LNFKLKKKDTQGFGE HEEECCCCCCCCCCC | - | ||
35 | Phosphorylation | TQGFGEESREPSTGD CCCCCCCCCCCCCCC | 21815630 | ||
39 | Phosphorylation | GEESREPSTGDNIRE CCCCCCCCCCCCHHH | 24719451 | ||
50 | Phosphorylation | NIREFLLSLRYFRIF CHHHHHHHHHHHHHH | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMIM7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMIM7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMIM7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SMIM7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...