SMDC1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMDC1_HUMAN
• UniProt AC: Q9NPB0
• Protein Name: SAYSvFN domain-containing protein 1
• Gene Name: SAYSD1
• Organism: Homo sapiens (Human).
• Sequence Length: 183
• Subcellular Localization: Cytoplasmic vesicle membrane ; Single-pass membrane protein .
• Protein Sequence: MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPASARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELEFGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Phosphorylation	AAQPPAASQGAQTPG CCCCCCHHCCCCCCC	31.11	25627689
30	Phosphorylation	AASQGAQTPGEKAEA CHHCCCCCCCHHHHH	32.50	25159151
145	Ubiquitination	TRGPEEKKEGEKSAY CCCHHHHCCCCCCCC	74.38	29967540
149	Ubiquitination	EEKKEGEKSAYSVFN HHHCCCCCCCCHHCC	51.77	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMDC1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMDC1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMDC1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of SMDC1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.