SMD2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMD2_MOUSE
• UniProt AC: P62317
• Protein Name: Small nuclear ribonucleoprotein Sm D2
• Gene Name: Snrpd2
• Organism: Mus musculus (Mouse).
• Sequence Length: 118
• Subcellular Localization: Cytoplasm, cytosol. Nucleus. SMN-mediated assembly into core snRNPs occurs in the cytosol before SMN-mediated transport to the nucleus to be included in spliceosomes..
• Protein Description: Core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Thereby, plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (By similarity)..
• Protein Sequence: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSLLNKPKS ------CCCCCCCHH	41.38	-
2	Phosphorylation	------MSLLNKPKS ------CCCCCCCHH	41.38	26824392
8	Ubiquitination	MSLLNKPKSEMTPEE CCCCCCCHHHCCHHH	61.73	22790023
9	Phosphorylation	SLLNKPKSEMTPEEL CCCCCCHHHCCHHHH	40.92	28833060
12	Phosphorylation	NKPKSEMTPEELQKR CCCHHHCCHHHHHHH	24.40	21082442
26	Phosphorylation	REEEEFNTGPLSVLT HHHHHHCCCCHHHHH	45.56	25777480
30	Phosphorylation	EFNTGPLSVLTQSVK HHCCCCHHHHHHHHH	20.43	25777480
33	Phosphorylation	TGPLSVLTQSVKNNT CCCHHHHHHHHHCCE	19.35	25777480
35	Phosphorylation	PLSVLTQSVKNNTQV CHHHHHHHHHCCEEE	29.80	25777480
46	S-palmitoylation	NTQVLINCRNNKKLL CEEEEEECCCCCHHH	3.80	28526873
63	S-nitrosocysteine	VKAFDRHCNMVLENV HHHHHHHHHHHHHHH	3.51	-
63	S-nitrosylation	VKAFDRHCNMVLENV HHHHHHHHHHHHHHH	3.51	24926564
98	Acetylation	NKDRYISKMFLRGDS CHHHHHHHHECCCCE	24.90	22826441
105	Phosphorylation	KMFLRGDSVIVVLRN HHECCCCEEEEEECC	19.30	29514104
118	Acetylation	RNPLIAGK------- CCCCCCCC-------	48.41	7609899
118	Ubiquitination	RNPLIAGK------- CCCCCCCC-------	48.41	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMD2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMD2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMD2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of SMD2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.